PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016481556.1 | ||||||||
Common Name | NtabSPL3b | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 136aa MW: 15790.5 Da PI: 7.8603 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 139.3 | 1.1e-43 | 52 | 127 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C+ad+++ak yhrrhkvCe+hskapvvl+sg++qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk++ XP_016481556.1 52 CQIEQCTADMADAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLAEFDEAKRSCRRRLAGHNERRRKTS 127 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 6.8E-59 | 1 | 136 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 2.3E-35 | 45 | 113 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.565 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.83E-40 | 50 | 130 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.1E-33 | 52 | 125 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MEDNKWEGKR SMNEAEEEEE EHENVEEDNK RKRVLTLSGR KQSSGGPALP SCQIEQCTAD 60 MADAKPYHRR HKVCEFHSKA PVVLISGIQQ RFCQQCSRFH QLAEFDEAKR SCRRRLAGHN 120 ERRRKTSYDS HGESSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-41 | 43 | 125 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LC073301 | 0.0 | LC073301.1 Nicotiana tabacum NtabSPL3b mRNA for squamosa promoter binding protein NtabSPL3b, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009602314.1 | 1e-97 | PREDICTED: squamosa promoter-binding protein 1-like isoform X2 | ||||
Refseq | XP_016481556.1 | 1e-97 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 4e-57 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A125SZP0 | 3e-96 | A0A125SZP0_TOBAC; Squamosa promoter-binding-like protein | ||||
STRING | XP_009602313.1 | 1e-83 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 3e-45 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 107802557 |
Publications ? help Back to Top | |||
---|---|---|---|
|