PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016481540.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 121aa MW: 14053.1 Da PI: 9.8116 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.1 | 5.6e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+d++ ++G g+W++ ++ g++R++k+c++rw +yl XP_016481540.1 14 KGPWTPEEDQKLIDYIDKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 57.8 | 2.4e-18 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE++ +++++ lG++ W++Ia +++ gRt++++k++w+++l XP_016481540.1 67 RGKFSEEEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-27 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.402 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.31E-33 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.7E-19 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.93E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.529 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-28 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-17 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.21E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MGRSPCCDEN GLKKGPWTPE EDQKLIDYID KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY 60 LRPDIKRGKF SEEEEQTILH LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG 120 Y |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-32 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009594598.1 | 6e-88 | PREDICTED: transcription factor MYB39-like | ||||
Refseq | XP_009790391.1 | 6e-88 | PREDICTED: myb-related protein 315-like | ||||
Refseq | XP_016464328.1 | 6e-88 | PREDICTED: transcription factor MYB39-like | ||||
Refseq | XP_019251501.1 | 7e-88 | PREDICTED: transcription factor MYB35-like | ||||
Swissprot | Q9S9Z2 | 3e-82 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A1J6INP7 | 2e-86 | A0A1J6INP7_NICAT; Transcription factor myb39 | ||||
TrEMBL | A0A1S3ZJ29 | 1e-86 | A0A1S3ZJ29_TOBAC; transcription factor MYB39-like | ||||
TrEMBL | A0A1U7XLA5 | 1e-86 | A0A1U7XLA5_NICSY; myb-related protein 315-like | ||||
STRING | XP_009790391.1 | 2e-87 | (Nicotiana sylvestris) | ||||
STRING | XP_009594598.1 | 2e-87 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 1e-84 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|