PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016480674.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 335aa    MW: 38951.1 Da    PI: 8.9865
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016480674.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16189235148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+++G + W+ Ia+ +  gR +kqc++rw+++l
   XP_016480674.1 189 KGQWTIEEDRLLIHLVEKFGVRKWSQIAQLLK-GRIGKQCRERWHNHL 235
                      799****************************9.*************97 PP

2Myb_DNA-binding57.43.4e-18243283345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l++a+++ G++ W+ Ia++++ gRt++++k++w+
   XP_016480674.1 243 LWTEEEDRILIEAHAEVGNK-WAEIAKRLP-GRTENSIKNHWN 283
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.628184239IPR017930Myb domain
SMARTSM007173.5E-15188237IPR001005SANT/Myb domain
SuperFamilySSF466897.26E-32189282IPR009057Homeodomain-like
PfamPF002496.8E-16189235IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-26190241IPR009057Homeodomain-like
CDDcd001672.07E-13192235No hitNo description
SMARTSM007176.8E-18240288IPR001005SANT/Myb domain
PROSITE profilePS5129422.892240290IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-23242289IPR009057Homeodomain-like
PfamPF002496.6E-17243283IPR001005SANT/Myb domain
CDDcd001671.78E-13244286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MELDPSNKQD LSFHPIFVPN NNSLKPELDD DFCIDSKDYF QDFQHLDLNF SLSGGVLPNY  60
TFNNTENFMI DTNGYDPFDP FSNEDNFSSL GDFNFSYELK PFDEENGNTI KENPMDVNYT  120
YNGCEDVKPL NFVVPDQSSS CVTNGSNCKL EIGELRKNKK VKRNDQSCLL SSSMKKLGRG  180
RNKKSKSAKG QWTIEEDRLL IHLVEKFGVR KWSQIAQLLK GRIGKQCRER WHNHLRPDIK  240
KDLWTEEEDR ILIEAHAEVG NKWAEIAKRL PGRTENSIKN HWNATKRRQF SRRKCRTKWP  300
RPSSLLQNYI KSLNLEKEAA KKILKLAMPQ TLVPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-451892904105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-4418929058159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-4418929058159MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-451892904105C-Myb DNA-Binding Domain
1msf_C4e-451892904105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192105e-79AC219210.1 Solanum lycopersicum chromosome 6 clone C06HBa0082B05, complete sequence.
GenBankAC2329445e-79AC232944.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 6 clone LE_HBa-24A16, complete sequence.
GenBankHG9755185e-79HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016480674.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L25e-79MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A1S4AVH30.0A0A1S4AVH3_TOBAC; transcription factor MYB98-like
STRINGXP_009603629.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-79myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]