PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016478471.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 122aa MW: 14033.3 Da PI: 10.3901 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.8 | 2.2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd lv +++++G+g+W++++ g+ R+ k+c++rw +yl XP_016478471.1 14 KGPWTPEEDIVLVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.8 | 1.6e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ +v++ ++lG++ W++Ia++++ Rt++++k++w+++l XP_016478471.1 67 RGNFTPHEEGMIVHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.939 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.06E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.78E-11 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-25 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.9E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.585 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.3E-13 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.70E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MGRPPCCDKI GIKKGPWTPE EDIVLVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TPHEEGMIVH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKKFQ 120 TG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP249696 | 1e-129 | KP249696.1 Solanum lycopersicum R2R3 MYB transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009628670.1 | 1e-88 | PREDICTED: myb-related protein 306 | ||||
Refseq | XP_016498669.1 | 1e-88 | PREDICTED: myb-related protein 306-like | ||||
Swissprot | B3VTV7 | 4e-87 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A0A1S4CCI6 | 3e-87 | A0A1S4CCI6_TOBAC; myb-related protein 306-like | ||||
STRING | XP_009628670.1 | 5e-88 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 9e-87 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|