PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016475371.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 547aa    MW: 61017.9 Da    PI: 5.4436
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016475371.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.84.4e-1381775471374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+++L++cA+a+++++l  a++l+++l++ +s  g+pmqRl ay++e+L arla+s+s++ykal+++e +   s+e +++++l++e++P++kf++
  XP_016475371.1 177 LKQVLIACAKAIADNNLVTAEWLMSELRTVVSVCGSPMQRLGAYMLEGLVARLASSGSSIYKALRCKEPT---SVELMSYMHLLYEICPYFKFGY 268
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     l aN aI++av++e+++HiiDf+i qG QW++L++aLa+Rp+gpp++RiTg+++++s   +   +e +g+rL+++A++++vpfef+  va +++d
  XP_016475371.1 269 LSANGAIVDAVKEENTIHIIDFQIAQGSQWITLIHALAARPGGPPRIRITGIDDSTSAyaRGGGIEIVGRRLSSIAASCNVPFEFHS-VAASCSD 362
                     ******************************************************998899999************************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +e+e+L+v+pgE laVn++l lh+++desv ++++rd++L++vkslsPk+v++veqe+++n+ +F+ rfle+l+yy ++f+s+++ lpr++++ri
  XP_016475371.1 363 VEIEHLKVRPGEPLAVNFALVLHHMPDESVGTKNHRDRLLRMVKSLSPKIVTLVEQESNTNTVQFFPRFLETLNYYLSIFESIDVALPRDHKQRI 457
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+reivn++acegaer+erhe le+Wr+r+ +aGF+p+pls+++++++k+ll+++++  y+++e++g+l+lgW++r Lv+ +aW+
  XP_016475371.1 458 NVEQHCLAREIVNIIACEGAERVERHELLERWRSRFLMAGFNPYPLSSSVNATIKTLLENYYQS-YTLDERNGALYLGWMNRDLVASCAWK 547
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.282151528IPR005202Transcription factor GRAS
PfamPF035141.5E-135177547IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MRPSQNAKDI NEFNRFYNQP VEDQESFSLP SINNPNSNQL LYADCGQQTQ FSALKHNQYC  60
YVESSTGNSN ELVSDSPPVD TFFAGDNSMM HQGSDSCPSD MHHSPNDTYH SSGNSSCFTS  120
DGTGLKHKLK ELETAMLGPD SESLESYNTT PLAAANQISS ESDKWVDMME MMPNGDLKQV  180
LIACAKAIAD NNLVTAEWLM SELRTVVSVC GSPMQRLGAY MLEGLVARLA SSGSSIYKAL  240
RCKEPTSVEL MSYMHLLYEI CPYFKFGYLS ANGAIVDAVK EENTIHIIDF QIAQGSQWIT  300
LIHALAARPG GPPRIRITGI DDSTSAYARG GGIEIVGRRL SSIAASCNVP FEFHSVAASC  360
SDVEIEHLKV RPGEPLAVNF ALVLHHMPDE SVGTKNHRDR LLRMVKSLSP KIVTLVEQES  420
NTNTVQFFPR FLETLNYYLS IFESIDVALP RDHKQRINVE QHCLAREIVN IIACEGAERV  480
ERHELLERWR SRFLMAGFNP YPLSSSVNAT IKTLLENYYQ SYTLDERNGA LYLGWMNRDL  540
VASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6518454626378Protein SCARECROW
5b3h_A2e-6518454625377Protein SCARECROW
5b3h_D2e-6518454625377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016475371.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A1S4AFF80.0A0A1S4AFF8_TOBAC; scarecrow-like transcription factor PAT1
STRINGXP_009626207.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]