PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016471310.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 87aa MW: 9609.37 Da PI: 10.3062 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 132.3 | 1.2e-41 | 21 | 87 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + ve+kG+nPGlivl vvggl+l fl+gny+ly+yaqk+lPP+kkkPvskkk+kre+lkqGv++PGe XP_016471310.1 21 KDVEVKGFNPGLIVLTVVGGLVLAFLIGNYVLYMYAQKTLPPKKKKPVSKKKMKRERLKQGVSAPGE 87 679***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 2.0E-6 | 22 | 87 | No hit | No description |
Pfam | PF04689 | 4.9E-40 | 23 | 87 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MDSEADFDPP PSFDNVKNMA KDVEVKGFNP GLIVLTVVGG LVLAFLIGNY VLYMYAQKTL 60 PPKKKKPVSK KKMKRERLKQ GVSAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232935 | 4e-70 | AC232935.1 Solanum lycopersicum chromosome 9 clone C09HBa0067J16, complete sequence. | |||
GenBank | HG975521 | 4e-70 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009627553.1 | 2e-56 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_009781429.1 | 2e-56 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_016432997.1 | 2e-56 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_016471310.1 | 2e-56 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 4e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A1S3WZD4 | 5e-55 | A0A1S3WZD4_TOBAC; DNA-binding protein S1FA-like | ||||
TrEMBL | A0A1S4A3X3 | 4e-55 | A0A1S4A3X3_TOBAC; DNA-binding protein S1FA-like | ||||
TrEMBL | A0A1U7X3I1 | 5e-55 | A0A1U7X3I1_NICSY; DNA-binding protein S1FA-like | ||||
STRING | XP_009781429.1 | 9e-56 | (Nicotiana sylvestris) | ||||
STRING | XP_009627553.1 | 7e-56 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 1e-06 | S1FA-like DNA-binding protein |