PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016470805.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 215aa MW: 24767.6 Da PI: 9.529 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.1 | 5.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien s rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++g+ly+++s XP_016470805.1 9 KRIENLSSRQVTFSKRRNGLLKKANELSVLCDAEVALIIFSQKGRLYDFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 69.8 | 8.6e-24 | 84 | 172 | 10 | 98 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ +e+l++e a++ k+ie L+ ++R+l+G++L+s+s+ eLq++ ++Le+sl++iR++K +l++++ie l+ ++ l een +Lr+k XP_016470805.1 84 LQQYMEHLKHETANMAKKIEILEVSKRKLMGQGLGSCSMDELQEIDSKLERSLENIRARKAQLFKDEIESLKARQCLLLEENANLREKC 172 467789********************************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.707 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.91E-40 | 3 | 71 | No hit | No description |
SuperFamily | SSF55455 | 2.35E-32 | 3 | 89 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.7E-23 | 87 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.862 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MVRGKVQMKR IENLSSRQVT FSKRRNGLLK KANELSVLCD AEVALIIFSQ KGRLYDFASS 60 NMQKTIERYH ERARETMVDN STELQQYMEH LKHETANMAK KIEILEVSKR KLMGQGLGSC 120 SMDELQEIDS KLERSLENIR ARKAQLFKDE IESLKARQCL LLEENANLRE KCRLMPTPSA 180 TPPTQRKERG NCSKNAQNSE VETELFIGLP VMRCS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
5f28_A | 3e-19 | 1 | 71 | 1 | 71 | MEF2C |
5f28_B | 3e-19 | 1 | 71 | 1 | 71 | MEF2C |
5f28_C | 3e-19 | 1 | 71 | 1 | 71 | MEF2C |
5f28_D | 3e-19 | 1 | 71 | 1 | 71 | MEF2C |
6byy_A | 3e-19 | 1 | 71 | 1 | 71 | MEF2 CHIMERA |
6byy_B | 3e-19 | 1 | 71 | 1 | 71 | MEF2 CHIMERA |
6byy_C | 3e-19 | 1 | 71 | 1 | 71 | MEF2 CHIMERA |
6byy_D | 3e-19 | 1 | 71 | 1 | 71 | MEF2 CHIMERA |
6c9l_A | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-19 | 1 | 71 | 1 | 71 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016470805.1 | 1e-157 | PREDICTED: MADS-box protein AGL42-like isoform X1 | ||||
Swissprot | Q9FIS1 | 5e-78 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1S4A2H5 | 1e-156 | A0A1S4A2H5_TOBAC; MADS-box protein AGL42-like isoform X1 | ||||
STRING | XP_009766770.1 | 1e-135 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-80 | AGAMOUS-like 42 |