PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016464761.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 158aa MW: 18305.1 Da PI: 9.304 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.7 | 2.7e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l +++++ G g+W ++ ++ g++R++k+c++rw +yl XP_016464761.1 15 KGPWTAEEDEKLMEYIQENGHGNWQLVHKRAGLNRCGKSCRLRWTNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.9 | 8.5e-17 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eE++ +++ + lG++ W++Ia++++ gRt++++k++w+++l XP_016464761.1 68 RGGFSEEEEQMIINFHSVLGNK-WSRIASHLP-GRTDNEIKNFWNTHL 113 788*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.298 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.34E-31 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-14 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.84E-11 | 17 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.5E-26 | 66 | 117 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.982 | 67 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 3.6E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-15 | 68 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.32E-11 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MGRYPCCKLD NDLKKGPWTA EEDEKLMEYI QENGHGNWQL VHKRAGLNRC GKSCRLRWTN 60 YLRLDIKRGG FSEEEEQMII NFHSVLGNKW SRIASHLPGR TDNEIKNFWN THLKKKLLKS 120 GIDPVTHQPI TDPTLLLSLC NLINPLESAL RLQAVKQN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-31 | 12 | 117 | 4 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016464761.1 | 1e-115 | PREDICTED: transcription factor MYB39-like | ||||
Swissprot | Q9S9Z2 | 2e-68 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A1S3ZK53 | 1e-114 | A0A1S3ZK53_TOBAC; transcription factor MYB39-like | ||||
STRING | XP_009803902.1 | 1e-111 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G16770.2 | 9e-72 | myb domain protein 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|