PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016462866.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 135aa MW: 15229.9 Da PI: 5.0732 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 163.6 | 2.8e-51 | 11 | 106 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqd++lPianv+rimk++lP nakisk+aketvqecvsefi+fvt+eas+kc++e+rkt+ngdd++wal+tlGf+dy ++k +l++yre ege XP_016462866.1 11 KEQDHLLPIANVGRIMKQILPPNAKISKEAKETVQECVSEFIGFVTGEASEKCRKERRKTVNGDDVCWALGTLGFDDYGGAMKRFLHRYRENEGE 105 89*******************************************************************************************99 PP NF-YB 97 k 97 k XP_016462866.1 106 K 106 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.3E-49 | 4 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.97E-36 | 13 | 110 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.2E-26 | 17 | 80 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.6E-14 | 44 | 62 | No hit | No description |
PRINTS | PR00615 | 2.6E-14 | 63 | 81 | No hit | No description |
PRINTS | PR00615 | 2.6E-14 | 82 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MAQNDEGSNS KEQDHLLPIA NVGRIMKQIL PPNAKISKEA KETVQECVSE FIGFVTGEAS 60 EKCRKERRKT VNGDDVCWAL GTLGFDDYGG AMKRFLHRYR ENEGEKVNQE RVDNNSGELE 120 ERPIGGSQPR NYNLD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-41 | 11 | 101 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-41 | 11 | 101 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016462866.1 | 2e-97 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1S3ZF00 | 4e-96 | A0A1S3ZF00_TOBAC; nuclear transcription factor Y subunit B-5-like | ||||
STRING | XP_009628180.1 | 1e-71 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-56 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|