PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016459816.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 74aa MW: 7847.75 Da PI: 5.8143 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 85 | 8.9e-27 | 27 | 74 | 2 | 49 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 reqdr+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tse XP_016459816.1 27 REQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSE 74 89********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.15E-16 | 21 | 74 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.4E-24 | 23 | 74 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.0E-16 | 32 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MAEPASPGGG GGSHESGGER SPQSNLREQD RYLPIANIGR IMKKALPANG KIAKDSKDTV 60 QECVSEFISF ITSE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-22 | 25 | 74 | 1 | 50 | NF-YB |
4awl_B | 2e-22 | 25 | 74 | 2 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-22 | 25 | 74 | 2 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 3e-22 | 26 | 74 | 1 | 49 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-22 | 26 | 74 | 1 | 49 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016438472.1 | 3e-48 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_016439627.1 | 4e-48 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
Refseq | XP_016459816.1 | 3e-48 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Swissprot | Q8VYK4 | 4e-31 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1S3XF20 | 6e-47 | A0A1S3XF20_TOBAC; nuclear transcription factor Y subunit B-10-like | ||||
TrEMBL | A0A1S3XIX5 | 9e-47 | A0A1S3XIX5_TOBAC; nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
STRING | XP_009782060.1 | 3e-47 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.6 | 2e-28 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|