PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016455169.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 123aa MW: 13598.9 Da PI: 5.8744 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 107.1 | 1e-33 | 51 | 108 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY+eClkNhA+ +GghavDGCg+fmp+ geegt++alkCaAC+CHRnFHR+eve e XP_016455169.1 51 SSVRYRECLKNHAVGIGGHAVDGCGDFMPA-GEEGTMDALKCAACNCHRNFHRKEVEGE 108 679**************************9.999*********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 8.0E-24 | 46 | 110 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.2E-30 | 53 | 105 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.0E-30 | 54 | 105 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 27.383 | 55 | 104 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MEFDEEHEEQ EEEIGNIHQI SSAAATVNYQ TQGNNSVRGV EEGVSTTVRK SSVRYRECLK 60 NHAVGIGGHA VDGCGDFMPA GEEGTMDALK CAACNCHRNF HRKEVEGEVF HHTPPPHLTH 120 HHP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009602563.1 | 1e-86 | PREDICTED: zinc-finger homeodomain protein 2-like | ||||
Refseq | XP_016455169.1 | 3e-87 | PREDICTED: mini zinc finger protein 1-like, partial | ||||
Swissprot | Q9M9S0 | 4e-29 | ZHD4_ARATH; Zinc-finger homeodomain protein 4 | ||||
TrEMBL | A0A1S3YSH0 | 8e-86 | A0A1S3YSH0_TOBAC; mini zinc finger protein 1-like | ||||
STRING | XP_009602563.1 | 5e-86 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA20279 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14440.2 | 5e-31 | homeobox protein 31 |