PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016452522.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 246aa MW: 28689.9 Da PI: 9.7732 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.2 | 2.8e-30 | 27 | 77 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fss+g++yeys+ XP_016452522.1 27 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSSRGRVYEYSN 77 79***********************************************95 PP | |||||||
2 | K-box | 101.2 | 1.4e-33 | 97 | 191 | 8 | 100 |
K-box 8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + ++e +a+ +qqe++kL+++i+++q+++Rhl+Ge+L+sL+++eL+qLe++Le+++++iRskK+e++l+++e+lqk+e +l++en Lr+k++e XP_016452522.1 97 ActTQELNAQFYQQESKKLRQQIQMIQNSNRHLVGEGLSSLNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENAFLRSKIAE 191 24478899************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.347 | 19 | 79 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.6E-41 | 19 | 78 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.88E-32 | 20 | 94 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.02E-41 | 20 | 92 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 21 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 21 | 41 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-25 | 28 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 41 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 56 | 77 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.0E-26 | 101 | 189 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.891 | 105 | 195 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MCTKFPLCMR FGEKPDHKMG RGKIEIKRIE NNTNRQVTFC KRRNGLLKKA YELSVLCEAE 60 IALIVFSSRG RVYEYSNNNI KATIDRYKKA TSETSNACTT QELNAQFYQQ ESKKLRQQIQ 120 MIQNSNRHLV GEGLSSLNVR ELKQLENRLE RGITRIRSKK HEMILAETEN LQKREIQLEQ 180 ENAFLRSKIA ENERLQELSM MPTGGQDYSA IQQYLARNML QLNMMEGGIP SYHQLPTDKK 240 SLELHE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | X81651 | 0.0 | X81651.1 P.hybrida mRNA for MADS box containing protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016452522.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-114 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A1S3YKP8 | 0.0 | A0A1S3YKP8_TOBAC; agamous-like MADS-box protein AGL11 | ||||
STRING | XP_009770275.1 | 1e-165 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-100 | MIKC_MADS family protein |