PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016452268.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 127aa MW: 14623.8 Da PI: 8.7142 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.1 | 6.3e-16 | 22 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l v+++G +W +++ g+ R++k+c++rw +yl XP_016452268.1 22 KGAWSEEEDNKLRAFVEKHGHSNWLQLPKYAGQMRCGKSCRLRWMNYL 69 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 38.3 | 3.1e-12 | 75 | 110 | 1 | 38 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 +g+ + eE+el+++++++lG++ W+ Ia+ ++ gR+++ XP_016452268.1 75 KGNYSHEEEELIIKLHNELGNR-WSVIAEQLP-GRSDN 110 7899******************.*********.***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-21 | 15 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.921 | 17 | 73 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.39E-27 | 19 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.3E-13 | 21 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-15 | 22 | 69 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.51E-10 | 24 | 69 | No hit | No description |
PROSITE profile | PS50090 | 8.502 | 70 | 110 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-18 | 72 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.0044 | 74 | 122 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-11 | 75 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.26E-7 | 77 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MVLIIAKKMV RTPSIDKNGM KKGAWSEEED NKLRAFVEKH GHSNWLQLPK YAGQMRCGKS 60 CRLRWMNYLR PGLKKGNYSH EEEELIIKLH NELGNRWSVI AEQLPGRSDN VGVEGFEPEG 120 FEADNLI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-22 | 22 | 111 | 7 | 95 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009766825.1 | 2e-90 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_016452268.1 | 2e-90 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9LDR8 | 2e-43 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A1S3YJP3 | 5e-89 | A0A1S3YJP3_TOBAC; myb-related protein Myb4-like | ||||
TrEMBL | A0A1U7VXW2 | 5e-89 | A0A1U7VXW2_NICSY; myb-related protein Myb4-like | ||||
STRING | XP_009766825.1 | 8e-90 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 7e-46 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|