PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 278aa    MW: 31797.5 Da    PI: 8.2208
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450035.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.6e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE + + da +++ ++    W  +a++++ g+t ++++  ++ 
   XP_016450035.1 28 KWTAEENKMFEDALALFDKDtpdKWYNVAAMIP-GKTVNDVIKQYRE 73
                     8********************************.********99986 PP

2Myb_DNA-binding46.39.7e-15133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_016450035.1 133 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 177
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-42374IPR009057Homeodomain-like
PROSITE profilePS512937.832479IPR017884SANT domain
SMARTSM007171.2E-92577IPR001005SANT/Myb domain
CDDcd001674.08E-72875No hitNo description
SuperFamilySSF466891.58E-112881IPR009057Homeodomain-like
PfamPF002493.3E-72874IPR001005SANT/Myb domain
PROSITE profilePS5129421.106126182IPR017930Myb domain
SuperFamilySSF466891.87E-17128181IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-18129181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-12130177IPR009057Homeodomain-like
SMARTSM007173.5E-13130180IPR001005SANT/Myb domain
CDDcd001671.02E-10133178No hitNo description
PfamPF002493.5E-12133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MKREMGFLSP ATYIKNSSWL FEENKVTKWT AEENKMFEDA LALFDKDTPD KWYNVAAMIP  60
GKTVNDVIKQ YRELVEDISD IEAGLIPVPG YTTSNSFTLE WVNNQDGFKQ FYGQTGKRGA  120
NRSSEHERKK GVPWTEEEHR QFLLGLKKYG KGDWRNISRN FVTTRTPTQV ASHAQKYFIR  180
QLSGGKDKRR SSIHDITVVN LSESKSTSPE NHSQQQHHSM VKTLCDYNSP NQEDITFNSS  240
SGDLITTPFR GVSSYGLEHG MHSITLQSLQ FGNYNTMC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1929941176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755211e-126HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016450035.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-99DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S3YCU70.0A0A1S3YCU7_TOBAC; transcription factor DIVARICATA-like
STRINGXP_009589244.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-110MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]