PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016448568.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 135aa MW: 15267.6 Da PI: 11.2171 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.1 | 5.3e-15 | 54 | 106 | 4 | 56 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +++rr++kNRe+A rsR+RK+a++ eLe v +Le+eN +L ke e +ke XP_016448568.1 54 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLKEEAEKNKER 106 689************************************99876544433333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-14 | 50 | 113 | No hit | No description |
SMART | SM00338 | 1.6E-11 | 51 | 115 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.0E-13 | 53 | 108 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.001 | 53 | 105 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 2.43E-17 | 55 | 101 | No hit | No description |
SuperFamily | SSF57959 | 6.88E-11 | 55 | 105 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 58 | 73 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MGNCQFPMAM QNGPLMGFGN GVVAIAGSGS GSGGSGRGKR RSTVEELPLD KATQQKQRRM 60 IKNRESAARS RERKQAYTVE LESLVTQLEE ENARLLKEEA EKNKERLKQI MENLIPVVEK 120 RRPPRVLRRV RSMSW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009783835.1 | 3e-91 | PREDICTED: G-box-binding factor 4-like | ||||
Refseq | XP_016448568.1 | 7e-93 | PREDICTED: G-box-binding factor 4-like | ||||
Swissprot | Q0JHF1 | 4e-34 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | A0A1S3Y9B1 | 1e-91 | A0A1S3Y9B1_TOBAC; G-box-binding factor 4-like | ||||
TrEMBL | A0A1U7XBK8 | 6e-90 | A0A1U7XBK8_NICSY; G-box-binding factor 4-like | ||||
STRING | XP_009783835.1 | 1e-90 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2771 | 24 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G03970.1 | 5e-24 | G-box binding factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|