PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016447855.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25557.4 Da PI: 9.6421 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.8 | 2.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrngi+KKA+ELSvLCdaevaviifs++g+lye+ss XP_016447855.1 9 KRIENATSRQVTFSKRRNGIMKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 77.1 | 4.6e-26 | 85 | 173 | 9 | 97 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 e+++e+l++e a++ k+ie L+ ++R+l+G++++s+s++eLq++ +qLe+slk+iR++K++l++++i++l+ kek+l een++L+++ XP_016447855.1 85 EVEHHMEHLKEETANIAKKIEILEVSKRKLMGQGIGSCSMNELQEIDSQLERSLKNIRARKTQLFKDKIQRLKAKEKQLLEENERLSEE 173 467889********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.366 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.34E-41 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.07E-33 | 3 | 85 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.5E-25 | 87 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.424 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MVRGKVQMKR IENATSRQVT FSKRRNGIMK KAYELSVLCD AEVAVIIFSQ KGRLYEFSSS 60 SMQKAIGRYR QYTKETLINN NSSLEVEHHM EHLKEETANI AKKIEILEVS KRKLMGQGIG 120 SCSMNELQEI DSQLERSLKN IRARKTQLFK DKIQRLKAKE KQLLEENERL SEECGLRRQP 180 EAPPPPLTRI SQQKETASCS HSVQNSEVET DLFIGLPDIC WS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-21 | 1 | 72 | 1 | 72 | MEF2C |
5f28_B | 4e-21 | 1 | 72 | 1 | 72 | MEF2C |
5f28_C | 4e-21 | 1 | 72 | 1 | 72 | MEF2C |
5f28_D | 4e-21 | 1 | 72 | 1 | 72 | MEF2C |
6byy_A | 4e-21 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 4e-21 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 4e-21 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 4e-21 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016447855.1 | 1e-163 | PREDICTED: MADS-box protein AGL42-like | ||||
Refseq | XP_016447856.1 | 1e-163 | PREDICTED: MADS-box protein AGL42-like | ||||
Swissprot | Q9FIS1 | 4e-83 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1S3Y6T8 | 1e-162 | A0A1S3Y6T8_TOBAC; MADS-box protein AGL42-like | ||||
STRING | XP_009630754.1 | 1e-115 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-85 | AGAMOUS-like 42 |