PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 467aa    MW: 51419.5 Da    PI: 7.4794
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444814.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-1855102148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd +l d+++++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_016444814.1  55 KGPWTKEEDAILMDYIRKHGEGNWSAVQKHSGLARCGKSCRLRWANHL 102
                      79******************************************9986 PP

2Myb_DNA-binding40.37.5e-13108151146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ T+eE   + ++++++G++ W+ Ia++++ gRt++++k++w++
   XP_016444814.1 108 KGALTPEEVRHINELHAKMGNK-WAQIAAKLP-GRTDNEIKNYWNT 151
                      6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.96150106IPR017930Myb domain
SuperFamilySSF466899.94E-3052149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2453105IPR009057Homeodomain-like
SMARTSM007171.0E-1454104IPR001005SANT/Myb domain
PfamPF002494.3E-1655102IPR001005SANT/Myb domain
CDDcd001671.64E-1257102No hitNo description
Gene3DG3DSA:1.10.10.606.3E-23106156IPR009057Homeodomain-like
SMARTSM007178.9E-12107155IPR001005SANT/Myb domain
PROSITE profilePS5129419.113107157IPR017930Myb domain
PfamPF002498.9E-12108151IPR001005SANT/Myb domain
CDDcd001674.77E-9112151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
TDHRLFAPSL CGQLLQLLSS VNAVDRMTSK VGVDSPSVEE ASGGGSTRGG VPLKKGPWTK  60
EEDAILMDYI RKHGEGNWSA VQKHSGLARC GKSCRLRWAN HLRPDLKKGA LTPEEVRHIN  120
ELHAKMGNKW AQIAAKLPGR TDNEIKNYWN TRIKKRQRAG LQIYPPDISF QAFSENKQNK  180
ELGIFSSANS HPDFLPINGF TIPTVEFKKL EPSQLLYPRA LLNIAASSFF DIPATSLLAQ  240
GLSSSNTCSG LSTMHPSKRI RGSESWFFGL NDDLFQACHQ YQNDGSLLAQ SLGFSSSYTH  300
NLTSDHHPSF SVEIPGSHAP LNGNSSSSEP KWAKKLELPS LQIQMENWGS PSPLPSLESF  360
DTLIQSPPNE HADSGSLSPR NSGLLDAVLY ESQTSKASKN NSHQETSCDV DDSYPDLQET  420
QWGRYSDPIS PLGHSAASVL SKYTPMEVHW MSPPVNSDGG WLSRRLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32501561107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444814.10.0PREDICTED: transcription factor GAMYB-like, partial
TrEMBLA0A1S3XY870.0A0A1S3XY87_TOBAC; transcription factor GAMYB-like
STRINGXP_009628008.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.16e-85myb domain protein 65