PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016442381.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 149aa MW: 16081.6 Da PI: 10.2669 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 80.6 | 2.2e-25 | 95 | 149 | 55 | 109 |
Whirly 55 falsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnl 109 falsatev++l+++++++sceffhdp++ +sn+G+vrk+l+ +P +dGsG+fv+l XP_016442381.1 95 FALSATEVGSLISIGTRDSCEFFHDPSMLSSNAGQVRKSLSFKPNADGSGYFVSL 149 9****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 2.0E-8 | 51 | 87 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 3.22E-26 | 57 | 149 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 2.3E-19 | 94 | 149 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 5.4E-21 | 94 | 149 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MAILKLAGFL RPRNQLLHKR LPGEGVRDSI WQHAINTLAG FSTVRQNIVA DAGKLTGRVF 60 APYSVFKGKA ALSAEPRLPT FCKLDQDIGL IGLLFALSAT EVGSLISIGT RDSCEFFHDP 120 SMLSSNAGQV RKSLSFKPNA DGSGYFVSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 5e-49 | 49 | 149 | 1 | 124 | StWhy2 |
3n1i_A | 5e-49 | 49 | 149 | 1 | 124 | protein StWhy2 |
3n1j_A | 5e-49 | 49 | 149 | 1 | 124 | Protein StWhy2 |
3n1k_A | 5e-49 | 49 | 149 | 1 | 124 | protein StWhy2 |
3n1l_A | 5e-49 | 49 | 149 | 1 | 124 | protein StWhy2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM234504 | 3e-66 | HM234504.1 Solanum tuberosum Why2 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016442381.1 | 1e-106 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like, partial | ||||
Swissprot | D9J034 | 9e-78 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A1S3XR04 | 1e-105 | A0A1S3XR04_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial-like | ||||
STRING | XP_009772771.1 | 4e-90 | (Nicotiana sylvestris) | ||||
STRING | XP_009598355.1 | 6e-90 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9782 | 22 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 1e-40 | WHIRLY 2 |