PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016440040.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10211.8 Da PI: 10.2883 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.7 | 1.8e-15 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+++Ed++l++++ ++G +W++++ g+ R +k+c++rw +yl XP_016440040.1 15 KGLWSPDEDDKLKNYIIKHGHSCWSSVPINAGLQRNGKSCRLRWINYL 62 678*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 9 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.343 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 4.2E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.5E-14 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.03E-19 | 17 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.64E-9 | 18 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-7 | 66 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MGCKSVDKTK QKHKKGLWSP DEDDKLKNYI IKHGHSCWSS VPINAGLQRN GKSCRLRWIN 60 YLRPGLKRGA FSLDEEETIL TLHAMFGNK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009629823.1 | 4e-60 | PREDICTED: transcription factor LAF1-like | ||||
Refseq | XP_016440040.1 | 2e-61 | PREDICTED: transcription factor LAF1-like | ||||
Swissprot | Q9M0K4 | 6e-39 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A1S3XJ88 | 4e-60 | A0A1S3XJ88_TOBAC; transcription factor LAF1-like | ||||
TrEMBL | A0A1S3XQZ6 | 6e-58 | A0A1S3XQZ6_TOBAC; transcription factor LAF1-like | ||||
TrEMBL | A0A1U7VLR8 | 6e-58 | A0A1U7VLR8_NICSY; transcription factor LAF1-like | ||||
STRING | XP_009629823.1 | 1e-59 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25560.1 | 3e-41 | myb domain protein 18 |
Publications ? help Back to Top | |||
---|---|---|---|
|