| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF822 | 53.9 | 7.4e-17 | 28 | 62 | 2 | 36 |
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaq 36
+++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaq
XP_016437198.1 28 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQ 62
799******************************98 PP
|
| 2 | DUF822 | 154.9 | 6.1e-48 | 64 | 169 | 28 | 133 |
DUF822 28 kiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpsp 122
kiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ +e++g+sa+++p+ss + s+ ss++asp++sy++sp+sssfpsp
XP_016437198.1 64 KIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCSRPAPMEIGGTSANITPSSSRHPSPPSSYFASPIPSYQPSPTSSSFPSP 158
9********************************************************************************************** PP
DUF822 123 ssldsislasa 133
s+ d ++++++
XP_016437198.1 159 SRGDANMSSHP 169
****9988754 PP
|
| Publications
? help Back to Top |
- Wang H, et al.
Dual role of BKI1 and 14-3-3 s in brassinosteroid signaling to link receptor with transcription factors.
Dev. Cell, 2011. 21(5): p. 825-34
[PMID:22075146] - Liu L, et al.
Ectopic expression of a BZR1-1D transcription factor in brassinosteroid signalling enhances carotenoid accumulation and fruit quality attributes in tomato.
Plant Biotechnol. J., 2014. 12(1): p. 105-15
[PMID:24102834] - Kim B, et al.
Darkness and gulliver2/phyB mutation decrease the abundance of phosphorylated BZR1 to activate brassinosteroid signaling in Arabidopsis.
Plant J., 2014. 77(5): p. 737-47
[PMID:24387668] - He X, et al.
A genotypic difference in primary root length is associated with the inhibitory role of transforming growth factor-beta receptor-interacting protein-1 on root meristem size in wheat.
Plant J., 2014. 77(6): p. 931-43
[PMID:24467344] - Oh E, et al.
Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl.
Elife, 2015.
[PMID:24867218] - Zhang D,Jing Y,Jiang Z,Lin R
The Chromatin-Remodeling Factor PICKLE Integrates Brassinosteroid and Gibberellin Signaling during Skotomorphogenic Growth in Arabidopsis.
Plant Cell, 2014. 26(6): p. 2472-2485
[PMID:24920333] - Shimada S, et al.
Formation and dissociation of the BSS1 protein complex regulates plant development via brassinosteroid signaling.
Plant Cell, 2015. 27(2): p. 375-90
[PMID:25663622] - Chaiwanon J,Wang ZY
Spatiotemporal brassinosteroid signaling and antagonism with auxin pattern stem cell dynamics in Arabidopsis roots.
Curr. Biol., 2015. 25(8): p. 1031-42
[PMID:25866388] - Zhang Y, et al.
Brassinosteroid is required for sugar promotion of hypocotyl elongation in Arabidopsis in darkness.
Planta, 2015. 242(4): p. 881-93
[PMID:25998528] - Jiang J, et al.
The Intrinsically Disordered Protein BKI1 Is Essential for Inhibiting BRI1 Signaling in Plants.
Mol Plant, 2015. 8(11): p. 1675-8
[PMID:26296798] - Zhang Y,He J
Sugar-induced plant growth is dependent on brassinosteroids.
Plant Signal Behav, 2015. 10(12): p. e1082700
[PMID:26340221] - Anne P, et al.
OCTOPUS Negatively Regulates BIN2 to Control Phloem Differentiation in Arabidopsis thaliana.
Curr. Biol., 2015. 25(19): p. 2584-90
[PMID:26387715] - Wang R, et al.
The Brassinosteroid-Activated BRI1 Receptor Kinase Is Switched off by Dephosphorylation Mediated by Cytoplasm-Localized PP2A B' Subunits.
Mol Plant, 2016. 9(1): p. 148-157
[PMID:26517938] - Youn JH, et al.
ARF7 increases the endogenous contents of castasterone through suppression of BAS1 expression in Arabidopsis thaliana.
Phytochemistry, 2016. 122: p. 34-44
[PMID:26608667] - Chaiwanon J,Garcia VJ,Cartwright H,Sun Y,Wang ZY
Immunophilin-like FKBP42/TWISTED DWARF1 Interacts with the Receptor Kinase BRI1 to Regulate Brassinosteroid Signaling in Arabidopsis.
Mol Plant, 2016. 9(4): p. 593-600
[PMID:26808213] - Yang X,Bai Y,Shang J,Xin R,Tang W
The antagonistic regulation of abscisic acid-inhibited root growth by brassinosteroids is partially mediated via direct suppression of ABSCISIC ACID INSENSITIVE 5 expression by BRASSINAZOLE RESISTANT 1.
Plant Cell Environ., 2016. 39(9): p. 1994-2003
[PMID:27149247] - Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
Nat Plants, 2016. 2: p. 16013
[PMID:27249348] - Zhang Z, et al.
TOR Signaling Promotes Accumulation of BZR1 to Balance Growth with Carbon Availability in Arabidopsis.
Curr. Biol., 2016. 26(14): p. 1854-60
[PMID:27345161] - Zhang Y, et al.
Functional characterization of GmBZL2 (AtBZR1 like gene) reveals the conserved BR signaling regulation in Glycine max.
Sci Rep, 2016. 6: p. 31134
[PMID:27498784] - Favero DS,Le KN,Neff MM
Brassinosteroid signaling converges with SUPPRESSOR OF PHYTOCHROME B4-#3 to influence the expression of SMALL AUXIN UP RNA genes and hypocotyl growth.
Plant J., 2017. 89(6): p. 1133-1145
[PMID:27984677] - Li H, et al.
BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis.
Mol Plant, 2017. 10(4): p. 545-559
[PMID:28089951] - Zentella R, et al.
The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA.
Nat. Chem. Biol., 2017. 13(5): p. 479-485
[PMID:28244988] - Espinosa-Ruiz A, et al.
TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
Development, 2017. 144(9): p. 1619-1628
[PMID:28320734] - Li QF, et al.
Light involved regulation of BZR1 stability and phosphorylation status to coordinate plant growth in Arabidopsis.
Biosci. Rep., 2018.
[PMID:28396515] - Thussagunpanit J, et al.
Characterization of synthetic ecdysteroid analogues as functional mimics of brassinosteroids in plant growth.
J. Steroid Biochem. Mol. Biol., 2017. 172: p. 1-8
[PMID:28479230] - Zhu JY, et al.
The F-box Protein KIB1 Mediates Brassinosteroid-Induced Inactivation and Degradation of GSK3-like Kinases in Arabidopsis.
Mol. Cell, 2017. 66(5): p. 648-657.e4
[PMID:28575660] - Yang M,Wang X
Multiple Ways of BES1/BZR1 Degradation to Decode Distinct Developmental and Environmental Cues in Plants.
Mol Plant, 2017. 10(7): p. 915-917
[PMID:28629641] - Lv B, et al.
Brassinosteroids regulate root growth by controlling reactive oxygen species homeostasis and dual effect on ethylene synthesis in Arabidopsis.
PLoS Genet., 2018. 14(1): p. e1007144
[PMID:29324765] - Ibañez C, et al.
Brassinosteroids Dominate Hormonal Regulation of Plant Thermomorphogenesis via BZR1.
Curr. Biol., 2018. 28(2): p. 303-310.e3
[PMID:29337075] - Saito M,Kondo Y,Fukuda H
BES1 and BZR1 Redundantly Promote Phloem and Xylem Differentiation.
Plant Cell Physiol., 2018. 59(3): p. 590-600
[PMID:29385529] - Li QF, et al.
The brassinosteroid-regulated transcription factors BZR1/BES1 function as a coordinator in multisignal-regulated plant growth.
Biochim Biophys Acta Gene Regul Mech, 2018. 1861(6): p. 561-571
[PMID:29673687] - Nosaki S, et al.
Structural basis for brassinosteroid response by BIL1/BZR1.
Nat Plants, 2018. 4(10): p. 771-776
[PMID:30287951]
|
