PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016435583.1 | ||||||||
Common Name | AG1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 238aa MW: 27514.1 Da PI: 9.9775 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.4 | 1.5e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ XP_016435583.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 74 79***********************************************8 PP | |||||||
2 | K-box | 110.6 | 1.7e-36 | 93 | 188 | 4 | 99 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 s++ s +ea+a+++qqe++kL+++i nLq+++R++lGe+L Lsl++L++Leq++ek+++kiRskKnell+++ie++qk+e +l+++n++Lr+k XP_016435583.1 93 SNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKREIDLHNNNQYLRAKQ 187 4444599*************************************************************************************997 PP K-box 99 e 99 + XP_016435583.1 188 Q 188 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-41 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.669 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.52E-45 | 18 | 94 | No hit | No description |
SuperFamily | SSF55455 | 3.01E-33 | 18 | 90 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-33 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.7E-27 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-33 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-33 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.1E-26 | 101 | 186 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.351 | 103 | 193 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MEFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNSVKA TIERYKKACS DSSNTGSISE ANAQYYQQEA SKLRAQIGNL 120 QNQNRNMLGE SLAALSLRDL KNLEQKIEKG ISKIRSKKNE LLFAEIEYMQ KREIDLHNNN 180 QYLRAKQQQQ QMNLMPGSSS YELVPPPQQF DTRNYLQVNG LQTNNHYTRQ DQPSLQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 2e-20 | 17 | 85 | 1 | 69 | MEF2C |
5f28_B | 2e-20 | 17 | 85 | 1 | 69 | MEF2C |
5f28_C | 2e-20 | 17 | 85 | 1 | 69 | MEF2C |
5f28_D | 2e-20 | 17 | 85 | 1 | 69 | MEF2C |
6byy_A | 2e-20 | 17 | 85 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 2e-20 | 17 | 85 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 2e-20 | 17 | 85 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 2e-20 | 17 | 85 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | TOBNAG1A | 0.0 | L23925.1 Nicotiana tabacum NAG1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016435583.1 | 1e-175 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 | ||||
Swissprot | Q43585 | 1e-168 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A1S3X770 | 1e-173 | A0A1S3X770_TOBAC; floral homeotic protein AGAMOUS-like isoform X3 | ||||
STRING | XP_009802759.1 | 1e-165 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-120 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 107812878 |
Publications ? help Back to Top | |||
---|---|---|---|
|