PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016434682.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 120aa MW: 12273.5 Da PI: 7.1607 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 92.3 | 4.8e-29 | 20 | 70 | 2 | 52 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasd 52 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+ea d XP_016434682.1 20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEARD 70 8************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.7E-18 | 12 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 5.2E-27 | 15 | 70 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.0E-17 | 25 | 69 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MADSDNESGG HNAGNEGSTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF 60 ISFITGEARD GGGGMYGGMG GGMIYHPQGH QMYGSHGSYH HMGMGGGGGG GGGGGGSRPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-24 | 14 | 68 | 1 | 55 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016434682.1 | 5e-81 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 5e-39 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A1S3X463 | 1e-79 | A0A1S3X463_TOBAC; nuclear transcription factor Y subunit B-3-like | ||||
STRING | XP_009787621.1 | 5e-41 | (Nicotiana sylvestris) | ||||
STRING | XP_009622977.1 | 3e-43 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 9e-41 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|