PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016433498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 295aa    MW: 34085.3 Da    PI: 9.3255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016433498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.9e-1688134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll++ v+++G + W+ Ia+t+  gR +kqc++rw+++l
   XP_016433498.1  88 KGQWTIEEDRLLIQSVEKFGVRKWSQIAQTLK-GRIGKQCRERWHNHL 134
                      799****************************9.*************97 PP

2Myb_DNA-binding56.37.3e-18142182345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l+ a+++ G++ W+ Ia++++ gRt++++k++w+
   XP_016433498.1 142 LWTEEEDRILISAHAEVGNK-WSEIAKRIP-GRTENSIKNHWN 182
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.36383134IPR017930Myb domain
SuperFamilySSF466891.76E-3187181IPR009057Homeodomain-like
SMARTSM007172.1E-1387136IPR001005SANT/Myb domain
PfamPF002492.0E-1488134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2789141IPR009057Homeodomain-like
CDDcd001677.76E-1291134No hitNo description
PROSITE profilePS5129426.635135189IPR017930Myb domain
SMARTSM007174.4E-17139187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-23142188IPR009057Homeodomain-like
PfamPF002491.5E-16142182IPR001005SANT/Myb domain
CDDcd001671.28E-12143185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDQDFNFNYE FKPFDQNGTS GSTLVNFNVV PDESSCITTG DNNGNYGKKE IGGRKNKKLV  60
TKSNENSLSS SSMRKLGRGR KKYSKSAKGQ WTIEEDRLLI QSVEKFGVRK WSQIAQTLKG  120
RIGKQCRERW HNHLRPDIKK DLWTEEEDRI LISAHAEVGN KWSEIAKRIP GRTENSIKNH  180
WNATKRRQFS RRKCRTKWPR PSSLLQNYIK SLNFEKGSND TILNNNAHEL CDKGNNIQQL  240
VADYDFSQVP EFGLDDKLFD DLEIPYNELP QLMQAGEVNK EAELMDLISC VNHEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-448818927128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777823.10.0PREDICTED: transcription factor MYB98-like
RefseqXP_016433498.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L26e-76MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A1S3X1D30.0A0A1S3X1D3_TOBAC; transcription factor MYB98-like
TrEMBLA0A1U7WGP30.0A0A1U7WGP3_NICSY; transcription factor MYB98-like
STRINGXP_009777823.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-76myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]