PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009799769.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 233aa    MW: 26915.8 Da    PI: 7.9528
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009799769.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-162669146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009799769.1 26 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 69
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.327120IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-10632IPR009057Homeodomain-like
SuperFamilySSF466895.43E-21679IPR009057Homeodomain-like
PROSITE profilePS5129423.2462175IPR017930Myb domain
SMARTSM007171.3E-142573IPR001005SANT/Myb domain
PfamPF002493.3E-152669IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-183370IPR009057Homeodomain-like
CDDcd001672.43E-74669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
KITGLKRTGK SCRLRWLNYL RPDVRRGNIT LEEQLLILEL HSRWGNRWSK IAQHLPGRTD  60
NEIKNYWRTR VQKHAKQLKC DVNSKQFKDT LRYLWMPRLA ERIQASSNSA ATTTITTTNN  120
SNNNNNNHVS TSVTQENSSV TASSENSMGT QVSPVSDISD CCYNNYPINQ NDYGELLISP  180
TGYFQNGALD FRTVDYNNQQ NMSQWMEGTE DVSDNLWNIE DMLFLQQQLN NDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-1777340106B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754442e-43HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755172e-43HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799769.11e-174PREDICTED: transcription factor MYB108-like, partial
SwissprotQ2QZJ89e-67JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBLA0A1U7YKK31e-172A0A1U7YKK3_NICSY; transcription factor MYB108-like
STRINGXP_009799769.11e-173(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-60myb domain protein 78
Publications ? help Back to Top
  1. Ahn IP,Kim S,Kang S,Suh SC,Lee YH
    Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct.
    Phytopathology, 2005. 95(11): p. 1248-55
    [PMID:18943354]
  2. Campos-Soriano L,García-Martínez J,San Segundo B
    The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection.
    Mol. Plant Pathol., 2012. 13(6): p. 579-92
    [PMID:22212404]
  3. Yokotani N, et al.
    Role of the rice transcription factor JAmyb in abiotic stress response.
    J. Plant Res., 2013. 126(1): p. 131-9
    [PMID:22847900]
  4. Wang D, et al.
    Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response.
    Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007
    [PMID:26740780]
  5. Fred AK,Kiswara G,Yi G,Kim KM
    Screening Rice Cultivars for Resistance to Bacterial Leaf Blight.
    J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45
    [PMID:26869604]