PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009792963.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 220aa MW: 26289.7 Da PI: 8.304 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50 | 6.7e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT++Ed++lv +vk++G ++W+ a+ g++Rt+k+c++rw +yl XP_009792963.1 8 RGPWTEQEDLQLVFYVKLFGDRRWDFLAKVSGLKRTGKSCRLRWVNYL 55 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.3 | 2.6e-16 | 61 | 106 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++ XP_009792963.1 61 RGKMTPQEERLVLELHCKWGNR-WSRIARKIP-GRTDNEIKNYWRTHM 106 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.984 | 3 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.56E-28 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.3E-13 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-14 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.9E-21 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.90E-8 | 10 | 55 | No hit | No description |
PROSITE profile | PS51294 | 26.129 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-14 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-14 | 61 | 105 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.0E-23 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.17E-9 | 63 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MVQEEIRRGP WTEQEDLQLV FYVKLFGDRR WDFLAKVSGL KRTGKSCRLR WVNYLNPDLK 60 RGKMTPQEER LVLELHCKWG NRWSRIARKI PGRTDNEIKN YWRTHMRKKA QEQRKKATSI 120 SPSSSFSNCS SSSITHEENE RNFYDTGGIE QLQVEEQKKV NDQEQAGESM KVYSMDEIWK 180 DIELLEENET INKPIMGSIS PLWDYCPDPM WKDFDWNTFR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-29 | 1 | 110 | 20 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00600 | PBM | Transfer from AT5G59780 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009792963.1 | 1e-164 | PREDICTED: transcription factor MYB48-like | ||||
Swissprot | Q4JL84 | 1e-71 | MYB59_ARATH; Transcription factor MYB59 | ||||
TrEMBL | A0A1U7XQ18 | 1e-163 | A0A1U7XQ18_NICSY; transcription factor MYB48-like | ||||
STRING | XP_009792963.1 | 1e-164 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46130.1 | 1e-72 | myb domain protein 48 |
Publications ? help Back to Top | |||
---|---|---|---|
|