PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792792.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 199aa    MW: 23393.2 Da    PI: 8.7067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792792.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73.1e-091153444
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     WT  Ed+l+ +a  +++ g   +W +Ia +++ g++++++  ++
   XP_009792792.1 11 WTRYEDKLFEEALVMYPEGvvnRWQKIAIHVP-GKSPEDVMAHY 53
                     ********************************.********998 PP

2Myb_DNA-binding43.38.5e-14109153347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+++W++I+r +  +Rt+ q+ s+ qky
   XP_009792792.1 109 PWTPEEHRLFLIGLERYGKDDWRSISRNVVVTRTPMQVASHAQKY 153
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.484660IPR017884SANT domain
SMARTSM007171.1E-7759IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-5957IPR009057Homeodomain-like
SuperFamilySSF466892.99E-12965IPR009057Homeodomain-like
PfamPF002493.4E-81153IPR001005SANT/Myb domain
CDDcd001675.68E-81153No hitNo description
PROSITE profilePS5129420.217102158IPR017930Myb domain
SuperFamilySSF466891.29E-17102159IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-16105157IPR006447Myb domain, plants
SMARTSM007172.4E-11106156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-11106154IPR009057Homeodomain-like
PfamPF002499.0E-12109153IPR001005SANT/Myb domain
CDDcd001672.81E-9109154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MYKIHSTSSI WTRYEDKLFE EALVMYPEGV VNRWQKIAIH VPGKSPEDVM AHYDALVHDV  60
FVIDSGRVEI PSYHDRSSEW EPESGTSRNI SFMSNYKNHT EQIRKKGTPW TPEEHRLFLI  120
GLERYGKDDW RSISRNVVVT RTPMQVASHA QKYFQRQEDI KKKERKRSSI HDIAVDANIL  180
LPQNNNQNQG GYQNYNFPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-13190190RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792792.11e-149PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016433214.11e-149PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-47DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S3X0021e-147A0A1S3X002_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7XL671e-147A0A1U7XL67_NICSY; transcription factor DIVARICATA-like
STRINGXP_009792792.11e-148(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-67MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]