PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792736.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 544aa    MW: 60628.2 Da    PI: 6.4078
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792736.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4271.5e-1301745441374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cAeav++ d + a+ l++ l++++s +g+pmqRl ay++e+L+arl++s+s++yk+l+++e +   ss+ l++++++++++P++kf++
  XP_009792736.1 174 LKDLLLACAEAVAEADISTAEVLMNVLEQRVSVSGEPMQRLSAYMLEGLRARLLSSGSTIYKKLKCNEPT---SSDLLSYMQVLYHICPYYKFAY 265
                     5789*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN  I ea+ +e+++HiiDf+i qG QW+ Ll+ La Rp+gpp +R+Tgv++++s   +   l+ +gerLak+Ae++gv+fef+  +a +   
  XP_009792736.1 266 MSANVVIGEAMRNENTIHIIDFQIAQGSQWMFLLHDLARRPGGPPYVRVTGVDDSQSAhaRGGGLKLVGERLAKVAESCGVSFEFHG-AAMSGCR 359
                     ******************************************************9988889999***********************.89999** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +ele+L+v++gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n+++Fl rf e+l+yy+a+f+s++a  +r++++ri
  XP_009792736.1 360 VELENLQVRHGEALAVNFPYMLHHMPDESVSTMNHRDRLLRLVKSLSPKIVTLVEQESNTNTAPFLPRFRETLDYYTAMFESTDAARSRDDKQRI 454
                     **************************************************************************************9******** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r++vn++acega+r+erhe ++kWr+rl +aGF+p++ls ++ +++k +l++++ + y++ e+++ l+lgWk+r+L + SaWr
  XP_009792736.1 455 SAEEHCIARDVVNIIACEGADRVERHEPFGKWRSRLVMAGFTPISLSPSVGETIKDMLKEYSPN-YKLAESQEVLYLGWKNRALATSSAWR 544
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.302148525IPR005202Transcription factor GRAS
PfamPF035145.3E-128174544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MQASQGPRRS GDVHRLYHQP MQQVQQYYTP YQAVDNNIYN DSSSSGTQFS FQTQNEQVFT  60
LDSLPATDYA IYDAAPSVSV SSNRSPFSPQ CSQSYISDPH HSFDNTCGSP VSGCSGVDDG  120
NGMKHALWEL KNKLRGPESD IDDSSSCSFN GVFSKPSSLT KRNQVLDIAS RLDLKDLLLA  180
CAEAVAEADI STAEVLMNVL EQRVSVSGEP MQRLSAYMLE GLRARLLSSG STIYKKLKCN  240
EPTSSDLLSY MQVLYHICPY YKFAYMSANV VIGEAMRNEN TIHIIDFQIA QGSQWMFLLH  300
DLARRPGGPP YVRVTGVDDS QSAHARGGGL KLVGERLAKV AESCGVSFEF HGAAMSGCRV  360
ELENLQVRHG EALAVNFPYM LHHMPDESVS TMNHRDRLLR LVKSLSPKIV TLVEQESNTN  420
TAPFLPRFRE TLDYYTAMFE STDAARSRDD KQRISAEEHC IARDVVNIIA CEGADRVERH  480
EPFGKWRSRL VMAGFTPISL SPSVGETIKD MLKEYSPNYK LAESQEVLYL GWKNRALATS  540
SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A8e-6218154325377Protein SCARECROW
5b3h_D8e-6218154325377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792736.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016448345.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A1S3Y8A30.0A0A1S3Y8A3_TOBAC; scarecrow-like protein 13
TrEMBLA0A1U7XSY60.0A0A1U7XSY6_NICSY; scarecrow-like protein 13
STRINGXP_009792736.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13