PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009789246.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 181aa MW: 20785 Da PI: 5.7473 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.8 | 1.4e-30 | 118 | 176 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+ +gCpvkk+ver++ed ++v++tYeg Hnh+ XP_009789246.1 118 LDDGYKWRKYGKKMVKDSPNPRNYYRCSVEGCPVKKRVERDKEDCRYVITTYEGVHNHQ 176 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.5E-32 | 104 | 178 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.54E-28 | 111 | 178 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.307 | 113 | 178 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.5E-34 | 118 | 177 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.8E-23 | 119 | 176 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MYTMRIQSIT MAANNPCTNM SYGSFRSLDS PDSDFSNQLI NFELSDIFEL DNWPVHDDPT 60 SVVSDPSQYS NYAANEVVTT ERSRSYQDGP TNNVGSSSEK KEVKDKVAFK TLSQIEILDD 120 GYKWRKYGKK MVKDSPNPRN YYRCSVEGCP VKKRVERDKE DCRYVITTYE GVHNHQGPSQ 180 F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-24 | 108 | 179 | 7 | 78 | Probable WRKY transcription factor 4 |
2ayd_A | 9e-25 | 106 | 178 | 2 | 74 | WRKY transcription factor 1 |
2lex_A | 1e-24 | 108 | 179 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ871280 | 0.0 | AJ871280.1 Nicotiana tabacum mRNA for putative WRKY transcription factor 10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009789246.1 | 1e-135 | PREDICTED: probable WRKY transcription factor 50 | ||||
Refseq | XP_016458903.1 | 1e-135 | PREDICTED: probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 2e-37 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1S3Z3G0 | 1e-133 | A0A1S3Z3G0_TOBAC; probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1U7XHV9 | 1e-133 | A0A1U7XHV9_NICSY; probable WRKY transcription factor 50 | ||||
STRING | XP_009789246.1 | 1e-134 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-38 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|