PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009785075.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 175aa MW: 20510 Da PI: 10.9854 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.9 | 3.2e-15 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l ++ ++G +W+ ++ g+ Rt+k+c++rw +yl XP_009785075.1 20 KGAWSPEEDKKLRAYIMKYGIWNWSQMPKFAGLSRTGKSCRLRWVNYL 67 79******************99************************97 PP | |||||||
2 | Myb_DNA-binding | 46.6 | 7.9e-15 | 73 | 118 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE ++ v+ ++lG++ W+tIa++++ gRt++++k++++++l XP_009785075.1 73 RGPFSMEEVDIVVKMYQELGNR-WSTIAARLP-GRTDNEVKNFFHTHL 118 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-22 | 15 | 70 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.882 | 15 | 71 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.57E-29 | 18 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-12 | 19 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-13 | 20 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.71E-10 | 22 | 67 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-23 | 71 | 122 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.4E-13 | 72 | 120 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.506 | 72 | 122 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.2E-12 | 73 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.38E-8 | 75 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MPRVPPQQQQ KSTNMEELKK GAWSPEEDKK LRAYIMKYGI WNWSQMPKFA GLSRTGKSCR 60 LRWVNYLSPD VKRGPFSMEE VDIVVKMYQE LGNRWSTIAA RLPGRTDNEV KNFFHTHLKK 120 HLGVKNNALV KSPRQDAKGW RKPKKMKRQI RSKLTKDLST PVYYHLMFLH PAAAL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-25 | 17 | 120 | 24 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 5e-34 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
GenBank | HG975515 | 5e-34 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009785075.1 | 1e-129 | PREDICTED: transcription factor MYB114-like | ||||
Refseq | XP_016462052.1 | 1e-129 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | Q7XBH4 | 4e-46 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | A0A1S3ZCU5 | 1e-128 | A0A1S3ZCU5_TOBAC; transcription factor MYB114-like | ||||
TrEMBL | A0A1U7XF47 | 1e-128 | A0A1U7XF47_NICSY; transcription factor MYB114-like | ||||
STRING | XP_009785075.1 | 1e-129 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 9e-47 | myb domain protein 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|