![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009779355.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 179aa MW: 20602 Da PI: 7.4943 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 97.7 | 7.6e-31 | 97 | 155 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C++ gC+vkk+ver+++d ++v++tYeg Hnhe XP_009779355.1 97 LDDGFKWRKYGKKMVKNSPNPRNYYKCSTGGCNVKKRVERDNDDSSYVITTYEGIHNHE 155 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.5E-32 | 83 | 157 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.72E-28 | 90 | 157 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.882 | 92 | 157 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.6E-36 | 97 | 156 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.5E-24 | 98 | 155 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MENFQYSNPN PNYGATDFIE TPEFELSDYL FPVDGLNDDF LLQNEMTSEF IQSISSYSNP 60 APSSTNNIKC TKGVKKYNKV IAKSRVAFRF KSDLEVLDDG FKWRKYGKKM VKNSPNPRNY 120 YKCSTGGCNV KKRVERDNDD SSYVITTYEG IHNHESPCVL HFTQFPPNIP TYGLHNLHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-24 | 92 | 157 | 12 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 3e-24 | 92 | 157 | 12 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975443 | 4e-41 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. | |||
GenBank | HG975516 | 4e-41 | HG975516.1 Solanum lycopersicum chromosome ch04, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009779355.1 | 1e-132 | PREDICTED: probable WRKY transcription factor 50 | ||||
Refseq | XP_016509832.1 | 1e-132 | PREDICTED: probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 3e-40 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1S4D8U5 | 1e-131 | A0A1S4D8U5_TOBAC; probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1U7WYP0 | 1e-131 | A0A1U7WYP0_NICSY; probable WRKY transcription factor 50 | ||||
STRING | XP_009779355.1 | 1e-132 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 5e-39 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|