PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009771204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 446aa    MW: 49142.8 Da    PI: 6.9107
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009771204.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l d+++++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_009771204.1 39 KGPWTKEEDAVLMDYIRKHGEGNWSAVQKHSGLARCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding43.38.6e-1492135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ T+eE  ++ ++++++G++ W+ Ia++++ gRt++++k++w++
   XP_009771204.1  92 KGALTPEEVRRINELHAKMGNK-WAQIAAKLP-GRTDNEIKNYWNT 135
                      6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.5663490IPR017930Myb domain
SuperFamilySSF466891.05E-2936133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-243789IPR009057Homeodomain-like
SMARTSM007177.9E-143888IPR001005SANT/Myb domain
PfamPF002492.2E-153986IPR001005SANT/Myb domain
CDDcd001677.33E-124186No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2390140IPR009057Homeodomain-like
PROSITE profilePS5129419.82291141IPR017930Myb domain
SMARTSM007174.3E-1391139IPR001005SANT/Myb domain
PfamPF002491.6E-1292135IPR001005SANT/Myb domain
CDDcd001673.82E-1096135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MCMTSECVDR MTSKVGVGSP SVEEASGGGN TRGGVPLKKG PWTKEEDAVL MDYIRKHGEG  60
NWSAVQKHSG LARCGKSCRL RWANHLRPDL KKGALTPEEV RRINELHAKM GNKWAQIAAK  120
LPGRTDNEIK NYWNTRIKKR RRVGLQIYPP DICFQAFSEN KQNNELGIFS SANSHPDFLP  180
INDFEIPTVE FKKLEPSQQL YPWALVNIAA SSFFDIPATS LLAQALSSSN TCSGLSTMHP  240
SKRIRGSESW FFGMTDNLFQ ACHQYQNNGS LFAQSLGFSS SYTHNLTSDN HPSFSGEIPG  300
SHAPLNGNSS SSEPKWAKKL ELPSLQIQMA NWGSPSPLPS LESFDTLIQY PPNEHADSGS  360
LSPRNSGLLD AVLYESQTSK ASKHNSHQET SCDVVDDSCP DLQETQWGTY SNPISPLGHS  420
AASVLSEYTP TEVHWMSPPV NSDGGW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31341401107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138142KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771204.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A1U7W9710.0A0A1U7W971_NICSY; transcription factor GAMYB-like isoform X1
STRINGXP_009771204.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.13e-78myb domain protein 65