PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009769180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family STAT
Protein Properties Length: 692aa    MW: 77935.8 Da    PI: 5.1243
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009769180.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT191.68.4e-602063251120
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldv+l++ +++p++ +vevvasL+yad+ ++vek+ d+eapLL++ydG+e++s+drp+k++ GrasfklkisqLsskcdnrLf+i+feipk+ +y
  XP_009769180.1 206 LDVTLMDNFSRPITEEVEVVASLVYADDEAPVEKPVDDEAPLLTNYDGIEYASSDRPSKVISGRASFKLKISQLSSKCDNRLFCIRFEIPKMGNY 300
                     89********************************************************************************************* PP

            STAT  96 pfleavskpirCisrsrntrssslt 120
                     pfle++s+pirCisr+rntr++sl+
  XP_009769180.1 301 PFLEVFSRPIRCISRNRNTRAASLM 325
                     ********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2004.1E-522149IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498991.98E-822126IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF555503.47E-10596654IPR000980SH2 domain
Gene3DG3DSA:3.30.505.101.5E-7596650IPR000980SH2 domain
PROSITE profilePS5000110.241598692IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MGIQDYGFLE DLQVEFKDYD ATNGVFLCFW FYLNKASTLP STILLQNHSD VTSHAPFLLL  60
DEKKRLLLYP LLTSWREDVY ATSESEFSTK KWVHVGCEVT ENLLRLYLDG EIVGEKSLTS  120
SLNNDSVSDS SEISFPCISG KGSQLDGYVY SAELLPVVSS IKNHYVKDPP VQLSIDSSSA  180
HEIEEDTDGV WSIVGGKASC RRNFSLDVTL MDNFSRPITE EVEVVASLVY ADDEAPVEKP  240
VDDEAPLLTN YDGIEYASSD RPSKVISGRA SFKLKISQLS SKCDNRLFCI RFEIPKMGNY  300
PFLEVFSRPI RCISRNRNTR AASLMLRKSS LGIHLLNGSQ SPILEDGSSD LPCIVREAKQ  360
SPSSKRVKLG QEKLCANFKD DFVLQQANGE SKSHSWISED NYAYLNSLVA RPVSHGGAQN  420
FSSDSENSET TNSGIDDFPS NRDPISDVDV FKYCLGDLNE RRLLLKEMAM SAKEEELATF  480
AERISLFSGC SHHRHQISIS KRLIEVGIKC WNLISDDNHH VLWENLVSGL QEHFLKMTFG  540
HTRSLTYQDF DLLRRVSGCQ DLVSQDNFEK VWCWLYPIAF TLSQQCITSL WGSAPPVWIE  600
GFITKEEAES SLRGQDPGTF ILRFPTSRSW PHPDSGNLVA TYVGSDYTIH HRLVSLDFIY  660
SSGAKGMTIK PIQDMLLEQP ELRRLGRIVR SQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103541e-132AC210354.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0102J11, complete sequence.
GenBankHG9755191e-132HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769180.10.0PREDICTED: uncharacterized protein LOC104220071
TrEMBLA0A1U7W4H60.0A0A1U7W4H6_NICSY; uncharacterized protein LOC104220071
STRINGXP_009769180.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B