PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009768847.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 245aa MW: 28323.2 Da PI: 9.0135 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 146.7 | 1.2e-45 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF+Pt+ee+v +yL +k+ + +l++ ++i+e++i+k++PwdLp + e++ yfFs+++ ky++g+r+nrat+sg Wk tg dk+++++ XP_009768847.1 14 LPPGFRFQPTEEEIVFQYLIRKTFSCPLPA-SIIPEINICKHDPWDLPGDI---EQDRYFFSNKEAKYRNGNRSNRATSSGCWKPTGLDKQITCS 104 79****************************.89***************554...5689***********************************98 PP NAM 96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ g+kktLvfykg+++++++t+W+mheyrl XP_009768847.1 105 kRKPILGMKKTLVFYKGKSSHASRTEWIMHEYRL 138 345559**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.14E-51 | 11 | 173 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.43 | 14 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.7E-24 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MDKFNFVKDG AIKLPPGFRF QPTEEEIVFQ YLIRKTFSCP LPASIIPEIN ICKHDPWDLP 60 GDIEQDRYFF SNKEAKYRNG NRSNRATSSG CWKPTGLDKQ ITCSKRKPIL GMKKTLVFYK 120 GKSSHASRTE WIMHEYRLVL PKNQPFNFHH FKKSSQSSMV QIGNWVLCHI FMKRRNGKCD 180 QDILEADHQH VQTPKQTLYY DFMREDLSYR AISSCSSSLS NDDSSEVSSS PSGLVEHEEA 240 SNRAL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-41 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-41 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-41 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-41 | 12 | 174 | 15 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 4e-41 | 12 | 178 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 4e-41 | 12 | 174 | 15 | 166 | NAC domain-containing protein 19 |
4dul_B | 4e-41 | 12 | 174 | 15 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009768847.1 | 0.0 | PREDICTED: NAC domain-containing protein 18 | ||||
Refseq | XP_016482046.1 | 0.0 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-72 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A1S4AZF9 | 0.0 | A0A1S4AZF9_TOBAC; NAC domain-containing protein 83-like | ||||
TrEMBL | A0A1U7VLI3 | 0.0 | A0A1U7VLI3_NICSY; NAC domain-containing protein 18 | ||||
STRING | XP_009768847.1 | 0.0 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 5e-74 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|