PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 275aa    MW: 31517.1 Da    PI: 9.1023
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767350.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.1e-082569345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      WT+eE +++  a + +      +W ++a  ++ g+t +++   + 
   XP_009767350.1 25 EWTQEENKKFESALAIYDETtpnRWFKVADLIP-GKTVYDVMKQYK 69
                     7*****************99*************.*******98876 PP

2Myb_DNA-binding40.75.6e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
   XP_009767350.1 126 PWTEEEHRRFLMGLDKHGKGDWRNISRNFVISKTPTQVASHAQKY 170
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-41770IPR009057Homeodomain-like
PROSITE profilePS512937.9252176IPR017884SANT domain
SMARTSM007173.2E-92274IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-112476IPR009057Homeodomain-like
PfamPF002491.6E-62569IPR001005SANT/Myb domain
CDDcd001676.53E-82571No hitNo description
Gene3DG3DSA:1.10.10.603.3E-11116173IPR009057Homeodomain-like
PROSITE profilePS5129419.38119175IPR017930Myb domain
SuperFamilySSF466893.23E-16120174IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17122174IPR006447Myb domain, plants
SMARTSM007178.4E-11123173IPR001005SANT/Myb domain
CDDcd001677.66E-9126170No hitNo description
PfamPF002493.8E-11126170IPR001005SANT/Myb domain
PROSITE profilePS514507.096193214IPR001611Leucine-rich repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
METLSPTSLI PNSSWMMMEQ RKSSEWTQEE NKKFESALAI YDETTPNRWF KVADLIPGKT  60
VYDVMKQYKE LAADVSDIEA GLFPVPPTYF TSSFMLDLVD DHHHRGVQSF KKRGRCYDQE  120
RKKGVPWTEE EHRRFLMGLD KHGKGDWRNI SRNFVISKTP TQVASHAQKY YLRQLSGGKD  180
KRRPSIHDIT TVNLTNIDLS DNNLNSSNNN KSLSSFAVNN PFQNSNDGAL MAFGSSYNRS  240
SYPYELGSVL SRGRYGTDNI SASDNSQIQR YQIWG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110122KKRGRCYDQERKK
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767350.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016475542.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H79e-85DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1S4AFU10.0A0A1S4AFU1_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7VZB70.0A0A1U7VZB7_NICSY; transcription factor DIVARICATA-like
STRINGXP_009767350.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-81MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]