PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009764099.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 348aa    MW: 38480.2 Da    PI: 8.7561
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009764099.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33167225159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYGqK vk+s+fprsYYrCt+a+C vkk+vers+ed+++v++tYeg H+h+
  XP_009764099.1 167 LDDGFRWRKYGQKAVKNSPFPRSYYRCTTATCGVKKRVERSSEDTSIVVTTYEGIHTHP 225
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-33152227IPR003657WRKY domain
SuperFamilySSF1182907.19E-29159227IPR003657WRKY domain
PROSITE profilePS5081130.71162227IPR003657WRKY domain
SMARTSM007744.2E-39167226IPR003657WRKY domain
PfamPF031064.9E-26168225IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MLLIKSMADK ENKLKPNTSS LEISTFSDQI PANNYSLSSI FDMPTCETEK GSSLSLIETM  60
FSSHPITTPS TFDLLQPPPP AVPLLVPSQI VNKIPSSEIV NTPNSSSISS SSTEAAANDD  120
QLQPNTQTVD DDDQHKNKKQ LKPKKKNQKR QREPRFAFMT KSEVDHLDDG FRWRKYGQKA  180
VKNSPFPRSY YRCTTATCGV KKRVERSSED TSIVVTTYEG IHTHPCPITP RSCIGILSET  240
TAYGGSIGGL GGNGGGSSLF IPQFHYQALQ QQPTYFQTPT LPMNFISTCD SSLYSSQERR  300
FSPSTSSSSS LARDHGLLQD MVPSQMRRDP KQDRVAFSLS TLSMKSQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-261602271077Probable WRKY transcription factor 4
2lex_A9e-261602271077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764098.10.0PREDICTED: probable WRKY transcription factor 48 isoform X1
RefseqXP_009764099.10.0PREDICTED: probable WRKY transcription factor 48 isoform X1
RefseqXP_009764100.10.0PREDICTED: probable WRKY transcription factor 48 isoform X1
SwissprotO229003e-53WRK23_ARATH; WRKY transcription factor 23
TrEMBLA0A1U7VQC70.0A0A1U7VQC7_NICSY; probable WRKY transcription factor 48 isoform X1
STRINGXP_009764098.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.15e-51WRKY DNA-binding protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. Prát T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]