PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009762153.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 449aa    MW: 48659.9 Da    PI: 5.1442
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009762153.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-163784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l d+v ++G g+W+++ +  g+ R++k+c++rw ++l
   XP_009762153.1 37 KGPWTSAEDAILMDYVMKHGEGNWNAVQKQSGLARCGKSCRLRWANHL 84
                     79******************************************9986 PP

2Myb_DNA-binding53.17.2e-1790133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ ++v++++++G++ W++ a++++ gRt++++k++w++
   XP_009762153.1  90 KGAFTPEEERRIVELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 133
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4613284IPR017930Myb domain
SuperFamilySSF466897.11E-3034131IPR009057Homeodomain-like
SMARTSM007177.8E-123686IPR001005SANT/Myb domain
PfamPF002492.6E-143784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-243891IPR009057Homeodomain-like
CDDcd001678.61E-103984No hitNo description
PROSITE profilePS5129425.59585139IPR017930Myb domain
SMARTSM007173.0E-1689137IPR001005SANT/Myb domain
PfamPF002491.6E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-2692137IPR009057Homeodomain-like
CDDcd001674.7E-1292133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSITVETDDM MTSKVDVDSP DEATGGVNAG GSEPLKKGPW TSAEDAILMD YVMKHGEGNW  60
NAVQKQSGLA RCGKSCRLRW ANHLRPDLKK GAFTPEEERR IVELHAKMGN KWARMAAELP  120
GRTDNEIKNY WNTRIKRHQR AGLPVYPPDI CFLASQNKQN EELSAFSSAD AQNPDVSGTN  180
DFDIPAVEFK NLELNRPLYP PPLFEIPSNS LLDITVSSFL AQGHSPPYNS TSFLSTMHPS  240
KRIRGSESMF GSNGGSLLGQ PLGFSSYNNH NVTYDDHLPF SSIVIPGSHA PLNGNSSSSE  300
ELPSLQNQTA NWGPPSSPLP SLESIDTLIH SPPAGHSESG SDLSPRNSGL LDAMLYGSHT  360
MKASTDNSHQ EKETFGDAVD NSYADPISPL SHFSASVFSE YAPIDGSSLH EFPSLATMPG  420
CKVKQENVAT SSGQACGRDS CTWDAMSTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30311371106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762153.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_009762156.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_009762161.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_009762167.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016468034.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016468041.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016468047.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016468055.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A1S3ZUF70.0A0A1S3ZUF7_TOBAC; transcription factor GAMYB-like
TrEMBLA0A1U7V1P90.0A0A1U7V1P9_NICSY; transcription factor GAMYB-like
STRINGXP_009762153.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.15e-74myb domain protein 33