PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009759500.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 229aa MW: 26352 Da PI: 9.0095 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 145 | 4.2e-45 | 5 | 135 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 pGfrF Pt+eel+++yL +k+egk+ el++vi+ v iy+++Pw+Lp+ + +++++w+fF++r++++a+g r+ r+t+sgyWkatg+ + v XP_009759500.1 5 SPGFRFYPTEEELISFYLLNKLEGKRPELDRVIPVVTIYNLDPWHLPNlpgeLCMGDTEQWFFFVPRQEREARGGRPCRTTTSGYWKATGSPTYV 99 69***************************999**************9657763334677************************************ PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +s++++++g+kk++vfykg+ap+g+kt+W m+eyr+ XP_009759500.1 100 YSSESKVIGVKKSMVFYKGKAPTGRKTKWKMNEYRA 135 **********************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.02E-49 | 3 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 47.774 | 4 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-23 | 6 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MVEISPGFRF YPTEEELISF YLLNKLEGKR PELDRVIPVV TIYNLDPWHL PNLPGELCMG 60 DTEQWFFFVP RQEREARGGR PCRTTTSGYW KATGSPTYVY SSESKVIGVK KSMVFYKGKA 120 PTGRKTKWKM NEYRAIEQET STSSSFSIPK LRHEMSLCRV YVISGSFRAF DRRPVATVTR 180 DTAAVKIQEL AGDRDNISSA ISVKNESKSY NIVESDFENL NGWEQINWM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-36 | 2 | 161 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-36 | 2 | 161 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-36 | 2 | 161 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-36 | 2 | 161 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swm_B | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swm_C | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swm_D | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swp_A | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swp_B | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swp_C | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
3swp_D | 2e-36 | 2 | 161 | 18 | 166 | NAC domain-containing protein 19 |
4dul_A | 2e-36 | 2 | 161 | 15 | 163 | NAC domain-containing protein 19 |
4dul_B | 2e-36 | 2 | 161 | 15 | 163 | NAC domain-containing protein 19 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB021178 | 0.0 | AB021178.1 Nicotiana tabacum TERN mRNA for NAC-domain protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001311942.1 | 1e-171 | NAC domain-containing protein 90 | ||||
Refseq | XP_009759500.1 | 1e-171 | PREDICTED: NAC domain-containing protein 90 | ||||
Swissprot | Q9FMR3 | 4e-84 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A1U7VCH0 | 1e-170 | A0A1U7VCH0_NICSY; NAC domain-containing protein 90 | ||||
TrEMBL | Q9SXQ0 | 1e-170 | Q9SXQ0_TOBAC; NAC domain-containing protein 90 | ||||
STRING | XP_009759500.1 | 1e-171 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2494 | 23 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 1e-86 | NAC domain containing protein 90 |
Publications ? help Back to Top | |||
---|---|---|---|
|