PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009757635.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 144aa MW: 16967.4 Da PI: 10.2465 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.9 | 1.1e-54 | 8 | 137 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 +ppGfrFhPtdeel+++yLkkk++ +k+++ evi+evd++k+ePwdL++k+k ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + XP_009757635.1 8 VPPGFRFHPTDEELLHYYLKKKISFQKFDM-EVIREVDLNKIEPWDLQEKCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCI 101 69****************************.99**************964444222455************************************ PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129 + + +++g++ktLvfy+grap+g+ktdW+mheyrle XP_009757635.1 102 RN-TFKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 137 *9.8899****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-55 | 5 | 139 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.157 | 8 | 144 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.2E-29 | 9 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MATSSGGVPP GFRFHPTDEE LLHYYLKKKI SFQKFDMEVI REVDLNKIEP WDLQEKCKIG 60 STPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNTFKKIGM RKTLVFYRGR 120 APHGQKTDWI MHEYRLEDAS LTGK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-50 | 2 | 136 | 9 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009757635.1 | 1e-106 | PREDICTED: protein BEARSKIN1 | ||||
Swissprot | Q9SV87 | 5e-96 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | A0A1U7V7B1 | 1e-105 | A0A1U7V7B1_NICSY; protein BEARSKIN1 | ||||
STRING | XP_009757635.1 | 1e-106 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA134 | 24 | 297 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 2e-98 | NAC domain containing protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|