PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_023405-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family Nin-like
Protein Properties Length: 926aa    MW: 102961 Da    PI: 6.3248
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_023405-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.56.3e-29620670252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ek isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  NNU_023405-RA 620 EKIISLQVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 670
                    789**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.836609690IPR003035RWP-RK domain
PfamPF020427.6E-25623670IPR003035RWP-RK domain
SuperFamilySSF542772.7E-20820914No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-20827909No hitNo description
SMARTSM006663.9E-23828911IPR000270PB1 domain
PROSITE profilePS5174525.056828911IPR000270PB1 domain
CDDcd064074.64E-35829910No hitNo description
PfamPF005641.8E-18829910IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MEDGFFPPNT ELGTLSNTPE DFDLSNELLL GGCWLETSGG SDFLQPGWSS TSAALSDSSY  60
FFPTPEISAG SLNPVPPRTD PEETTGSSFL ANQPHVETET EDDIRTPNTV ISANSSGRAE  120
CYPAIGSSKL KKKWWIGPSS NPGPSVRERL IQAVGYIRES TKDRDVLIQI WVPVKRGGKH  180
VLTTDGQPFS LDPNCRRLAN YRNASLNYQF PAEENSEETV GLPGRVFLGK VPEWTPDVRF  240
YDSDEYPRID YAQRCDVRGT VALPVFERTS RTCLGVVEVV MTTQKINYRP EFESVCRALE  300
AVDLRSSEVP MSSHLKVTSN SYQAALPEIL EVLRVACETH SLPLAQTWVP CIQQCKGGYR  360
HSDDNYADCV STMDSACHMG DPLLWGFHEA CSEHHFFRGQ GVVGKAFTTN QLCFSTDVTT  420
FSKTEYPLLH YARMFGLRAA VAIHLRSTRT ETTDYVLEFF LPVDCVDIEK QKVILNSLFI  480
IVQQVRQSLQ VITDKELVEE TDFLVSEVTT PSNGTSDRKK LSNFRSMESI GSCKEESSEI  540
AYIMESQQKD KSVPVVFQKE EPTVEYKITT NGKMLSEYEQ HLRDPGPRYS IDCHGKSSDF  600
GEGTYSSGGR TGEKRRTKTE KIISLQVLQQ YFAGSLKDAA KSIGVCPTTL KRICRQHGIT  660
RWPSRKIKKV GHSLRKLKVV IDSVQGADGV FQIGSFHLNF SDPTSPNDDP KSLKATSWGA  720
ISSLVAPPKS PSTSYTQSSV SSHCISTGIQ QHAHAIHLAG SEDISVSEKA GGVLTRSCND  780
AELHASSQEE IKPLARSHTQ KSLCEHPTLE NLPPLPRSGS HVSQSVGAIR VKVTYEEDKI  840
RFSLQSTWGF KDLQQEIAER FNIDDTNRIE LKYMVNDSKW VLLTCDADLG DCIDIYKSSR  900
SRTIKLFVHQ VSHPSMETSL VRSGPS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242905.10.0PREDICTED: protein NLP4-like
TrEMBLA0A1U7YXU90.0A0A1U7YXU9_NELNU; protein NLP4-like
STRINGXP_010242905.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein