PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_021998-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13180.9 Da PI: 5.2184 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 172.3 | 5.3e-54 | 31 | 121 | 2 | 92 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdrflPian+srimkkv+P n+ki+kdak+ vqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl+ yre NNU_021998-RA 31 REQDRFLPIANISRIMKKVIPPNGKIAKDAKDCVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIAPLKMYLQLYRE 121 89****************************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.7E-50 | 28 | 121 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.21E-38 | 33 | 121 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.9E-29 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.7E-20 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.7E-20 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 9.7E-20 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MAESGAPGTP ESVHSGEQGG GGAQSGGTGP REQDRFLPIA NISRIMKKVI PPNGKIAKDA 60 KDCVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM ATLGFEDYIA PLKMYLQLYR 120 E |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 5e-48 | 31 | 121 | 3 | 93 | NF-YB |
4awl_B | 5e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010279615.1 | 2e-86 | PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X3 | ||||
Swissprot | P25209 | 7e-58 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
Swissprot | Q9SLG0 | 7e-58 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A1U8BHB7 | 5e-85 | A0A1U8BHB7_NELNU; nuclear transcription factor Y subunit B-3-like isoform X3 | ||||
STRING | XP_010279613.1 | 3e-85 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 1e-58 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|