PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_019373-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 105aa MW: 12144.8 Da PI: 10.4208 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 119 | 1.8e-37 | 25 | 85 | 2 | 63 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 +e+alkcprCdstntkfCyy nyslsqPryfCkaCrryWtkGG+lrnvPv gg+rknk+sss NNU_019373-RA 25 PEQALKCPRCDSTNTKFCYY-NYSLSQPRYFCKACRRYWTKGGSLRNVPVVGGCRKNKRSSS 85 7899****************.5************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-24 | 14 | 77 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 6.6E-31 | 27 | 82 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 26.077 | 29 | 82 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MATHSLEDIL AYPKPQQERK SRPQPEQALK CPRCDSTNTK FCYYNYSLSQ PRYFCKACRR 60 YWTKGGSLRN VPVVGGCRKN KRSSSSKKTQ DSSLITTNSN QRCQR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}. | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010244980.1 | 2e-63 | PREDICTED: dof zinc finger protein DOF3.2-like | ||||
Swissprot | O24463 | 1e-34 | PBF_MAIZE; Dof zinc finger protein PBF | ||||
Swissprot | Q84TE9 | 3e-35 | DOF53_ARATH; Dof zinc finger protein DOF5.3 | ||||
TrEMBL | A0A1U7ZB29 | 5e-62 | A0A1U7ZB29_NELNU; dof zinc finger protein DOF3.2-like | ||||
STRING | XP_010244980.1 | 9e-63 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60200.1 | 1e-31 | TARGET OF MONOPTEROS 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|