PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_015351-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 179aa MW: 19910.2 Da PI: 6.2796 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.3 | 6.1e-55 | 35 | 130 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy+eplk yl+++relegek NNU_015351-RA 35 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGTLGFDDYAEPLKRYLHRFRELEGEK 130 79********************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.1E-53 | 30 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.11E-40 | 37 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.7E-28 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.8E-19 | 68 | 86 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.8E-19 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 6.8E-19 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MVDNIGSHGP NSEGNKYKIA GGAASTSSGD DRSLKEQDRL LPIANVGRIM KQILPPNAKI 60 SKEAKETMQE CVSEFISFVT GEASDKCHKE KRKTVNGDDI CWALGTLGFD DYAEPLKRYL 120 HRFRELEGEK ANQDKGSNIE NREAPSFFGC DKTREQPLSS TPLDFNVFEK SNSSMSRPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-44 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-44 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM429706 | 2e-79 | AM429706.1 Vitis vinifera contig VV78X144965.37, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010269452.1 | 1e-132 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O82248 | 2e-60 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1U8ANS8 | 1e-131 | A0A1U8ANS8_NELNU; nuclear transcription factor Y subunit B-4 | ||||
STRING | XP_010269452.1 | 1e-131 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-62 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|