PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_012422-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 89aa MW: 9923.83 Da PI: 10.4373 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 133 | 7.7e-42 | 23 | 89 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + +eakG+nPGlivllvv +lllvflvgny+ly+yaqk+lPPrkkkP+skkk+k+e+lkqGv++PGe NNU_012422-RA 23 KDAEAKGFNPGLIVLLVVVSLLLVFLVGNYALYMYAQKTLPPRKKKPISKKKMKKERLKQGVSAPGE 89 568***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 9.2E-41 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
ProDom | PD019013 | 1.0E-5 | 28 | 89 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MADDFEFSDK VPPSFERVGN VIKDAEAKGF NPGLIVLLVV VSLLLVFLVG NYALYMYAQK 60 TLPPRKKKPI SKKKMKKERL KQGVSAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010264750.1 | 1e-57 | PREDICTED: DNA-binding protein S1FA | ||||
Refseq | XP_010264751.1 | 1e-57 | PREDICTED: DNA-binding protein S1FA | ||||
Swissprot | P42553 | 9e-18 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | A0A1U8ABC1 | 3e-56 | A0A1U8ABC1_NELNU; DNA-binding protein S1FA | ||||
STRING | XP_010264750.1 | 5e-57 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 2e-06 | S1FA-like DNA-binding protein |