PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_009283-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 132aa MW: 14121.9 Da PI: 5.2454 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 156.7 | 3.8e-49 | 44 | 129 | 2 | 87 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy+eplk + NNU_009283-RA 44 KEQDRLLPIANVGRIMKQILPLNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGTLGFDDYAEPLKSLI 129 89********************************************************************************9877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.6E-47 | 40 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.55E-35 | 46 | 129 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.8E-27 | 49 | 113 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.8E-16 | 77 | 95 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 80 | 96 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.8E-16 | 96 | 114 | No hit | No description |
PRINTS | PR00615 | 8.8E-16 | 115 | 132 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MVDNIGSRSP DWEGNNKYKS TAGGGASAIR GASASAAGDD GSIKEQDRLL PIANVGRIMK 60 QILPLNAKIS KEAKETMQEC VSEFISFVTG EASDKCHKEK RKTVNGDDIC WALGTLGFDD 120 YAEPLKSLIA TI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-41 | 43 | 126 | 1 | 84 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-41 | 43 | 126 | 1 | 84 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010259679.1 | 9e-90 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 5e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1U8A0J5 | 2e-88 | A0A1U8A0J5_NELNU; nuclear transcription factor Y subunit B-5-like | ||||
STRING | XP_010259679.1 | 3e-89 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-53 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|