PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | NNU_004690-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 91aa MW: 10565 Da PI: 4.1555 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 48.4 | 3e-15 | 14 | 61 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 l+pGf+F Ptdeel+v+yL +k+++ +l++ ++i+e++iy+++P++L NNU_004690-RA 14 LAPGFKFAPTDEELIVYYLDEKTRDPTLRI-DTITEINIYQFDPQQLID 61 579***************************.88**************63 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-14 | 12 | 62 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 14.861 | 14 | 91 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.3E-7 | 16 | 62 | IPR003441 | NAC domain |
Gene3D | G3DSA:2.40.50.140 | 1.6E-4 | 57 | 84 | IPR012340 | Nucleic acid-binding, OB-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MERKPWKNVK GIMLAPGFKF APTDEELIVY YLDEKTRDPT LRIDTITEIN IYQFDPQQLI 60 DGFEKLLTKT GETKDDSQLP TDETLPFADP E |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019052656.1 | 8e-24 | PREDICTED: NAC domain-containing protein 13-like | ||||
TrEMBL | A0A1U8Q3Q1 | 2e-22 | A0A1U8Q3Q1_NELNU; NAC domain-containing protein 13-like | ||||
STRING | XP_010251982.1 | 3e-24 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34180.2 | 1e-12 | NAC domain containing protein 16 |