 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | NNU_000694-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 103aa MW: 11313.9 Da PI: 10.706 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 24.5 | 5.6e-08 | 26 | 92 | 20 | 86 |
NF-YC 20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrt 86
++ + ri lkad+ +++ a +Pv l+ e+++ e+ +w+ ++nk++ + i+ av +
NNU_000694-RA 26 QFLVGRIASFLKADKYTERVGAGVPVYLAAVLEYLVAEVLELAWNAVRDNKKTRIVPRHIQLAVRNX 92
67789************************************************99999999999875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00414 | 4.3E-33 | 4 | 103 | IPR002119 | Histone H2A |
| SuperFamily | SSF47113 | 1.3E-33 | 5 | 94 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-40 | 9 | 94 | IPR009072 | Histone-fold |
| Pfam | PF00125 | 1.1E-11 | 10 | 90 | IPR007125 | Histone H2A/H2B/H3 |
| PRINTS | PR00620 | 1.8E-34 | 15 | 37 | IPR002119 | Histone H2A |
| PRINTS | PR00620 | 1.8E-34 | 44 | 59 | IPR002119 | Histone H2A |
| PRINTS | PR00620 | 1.8E-34 | 59 | 72 | IPR002119 | Histone H2A |
| PRINTS | PR00620 | 1.8E-34 | 73 | 87 | IPR002119 | Histone H2A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000786 | Cellular Component | nucleosome | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MAGRGKSLGA EASKKAASRS SKVGLQFLVG RIASFLKADK YTERVGAGVP VYLAAVLEYL 60 VAEVLELAWN AVRDNKKTRI VPRHIQLAVR NXEEQERSKK IAD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6c0w_C | 2e-40 | 1 | 94 | 1 | 93 | Histone H2A |
| 6c0w_G | 2e-40 | 1 | 94 | 1 | 93 | Histone H2A |
| 6j50_c | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6j50_g | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6j51_c | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6j51_g | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r8y_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r8y_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r8z_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r8z_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r90_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r90_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r91_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r91_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r92_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r92_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r93_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r93_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r94_C | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| 6r94_G | 2e-40 | 1 | 94 | 4 | 96 | Histone H2A type 1-B/E |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. | |||||
| UniProt | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010241030.1 | 8e-51 | PREDICTED: protein H2A.7 | ||||
| Swissprot | A2YVE5 | 9e-50 | H2A3_ORYSI; Probable histone H2A.3 | ||||
| Swissprot | Q84NJ4 | 9e-50 | H2A3_ORYSJ; Probable histone H2A.3 | ||||
| TrEMBL | A0A1U7YMG1 | 2e-49 | A0A1U7YMG1_NELNU; Histone H2A | ||||
| STRING | XP_010241030.1 | 3e-50 | (Nelumbo nucifera) | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|