PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf37484g00001.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 9320.86 Da PI: 10.6309

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf37484g00001.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.3	8.3e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Niben101Scf37484g00001.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.529	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.17E-40	2	68	No hit	No description
SuperFamily	SSF55455	9.03E-32	2	68	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.1E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.1E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.1E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST 60 SRYYKNNHFF LHHLLQSW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	1	61	1	61	MEF2C
5f28_B	1e-20	1	61	1	61	MEF2C
5f28_C	1e-20	1	61	1	61	MEF2C
5f28_D	1e-20	1	61	1	61	MEF2C
6byy_A	9e-21	1	61	1	61	MEF2 CHIMERA
6byy_B	9e-21	1	61	1	61	MEF2 CHIMERA
6byy_C	9e-21	1	61	1	61	MEF2 CHIMERA
6byy_D	9e-21	1	61	1	61	MEF2 CHIMERA
6bz1_A	1e-20	1	61	1	61	MEF2 CHIMERA
6bz1_B	1e-20	1	61	1	61	MEF2 CHIMERA
6bz1_C	1e-20	1	61	1	61	MEF2 CHIMERA
6bz1_D	1e-20	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269\|PubMed:28528644}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020205010.1	9e-38	developmental protein SEPALLATA 1 isoform X5
Refseq	XP_020205011.1	1e-37	developmental protein SEPALLATA 1 isoform X6
Refseq	XP_022850778.1	3e-38	MADS-box protein EJ2-like
Swissprot	Q7Y040	4e-37	EJ2_SOLLC; MADS-box protein EJ2
TrEMBL	A0A4D8YDK4	1e-37	A0A4D8YDK4_SALSN; MADS-box transcription factor, plant
STRING	cassava4.1_030388m	9e-38	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15800.1	9e-39	MIKC_MADS family protein

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Soyk S, et al. Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene. Cell, 2017. 169(6): p. 1142-1155.e12 [PMID:28528644]