PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf15739g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 188aa MW: 22061.1 Da PI: 10.9047 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.8 | 1.6e-15 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ ++ ++G +W+ +r g+ Rt+k+c++rw +yl Niben101Scf15739g00010.1 20 KGAWSPEEDHKLISYIMRYGIWNWSHMPRFAGLSRTGKSCRLRWMNYL 67 79******************99************************97 PP | |||||||
2 | Myb_DNA-binding | 42.8 | 1.2e-13 | 73 | 118 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE e ++ ++lG++ W+ Ia++++ gRt++++k++++++l Niben101Scf15739g00010.1 73 RGPFSIEERETVIKTYQELGNR-WSEIAARLP-GRTDNEVKNFFHTHL 118 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.293 | 15 | 67 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-22 | 15 | 70 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.49E-28 | 18 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.2E-11 | 19 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.8E-14 | 20 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.45E-8 | 22 | 67 | No hit | No description |
PROSITE profile | PS51294 | 21.616 | 68 | 122 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.7E-24 | 71 | 122 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-11 | 72 | 120 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-12 | 73 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.20E-7 | 75 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MPRVPPQQQQ KSTNMEEIKK GAWSPEEDHK LISYIMRYGI WNWSHMPRFA GLSRTGKSCR 60 LRWMNYLRPD VKRGPFSIEE RETVIKTYQE LGNRWSEIAA RLPGRTDNEV KNFFHTHLKK 120 HLRVKNDAPS KTKARSNKRE VKKTKGNERT NADKRSPDVS SSDRSSIITF EVNQMMDVTM 180 NSTQNVPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-25 | 17 | 120 | 24 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019244719.1 | 1e-123 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9SJX8 | 2e-49 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A1J6J4Q5 | 1e-122 | A0A1J6J4Q5_NICAT; Myb-related protein myb4 | ||||
STRING | XP_009798928.1 | 1e-117 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 1e-49 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|