PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf15437g02005.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

GRAS

Protein Properties

Length: 107aa MW: 12599.5 Da PI: 8.4864

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf15437g02005.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	122.9	3.8e-38	1	106	267	373
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351 +f+s++++l r+ +eri+vE+++l+r+ivnv+aceg+er+erhe l+kW+ r+++aGF+++pls+++++ +k+llr ++ + y++ Niben101Scf15437g02005.1 1 MFESIDVTLERDRKERINVEQHCLARDIVNVIACEGKERVERHELLGKWKLRFTMAGFRQYPLSSYVNSVIKSLLRCYS-EHYTL 84 7************************************************************************9999.66* PP GRAS 352 eeesgslvlgWkdrpLvsvSaW 373 e++g+++lgWkdr+L+s+SaW Niben101Scf15437g02005.1 85 VEKDGAMLLGWKDRNLISASAW 106 ********************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50985	18.666	1	88	IPR005202	Transcription factor GRAS
Pfam	PF03514	1.3E-35	1	106	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MFESIDVTLE RDRKERINVE QHCLARDIVN VIACEGKERV ERHELLGKWK LRFTMAGFRQ 60 YPLSSYVNSV IKSLLRCYSE HYTLVEKDGA MLLGWKDRNL ISASAWH

Functional Description ? help Back to Top
Source	Description
UniProt	May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269\|PubMed:12591613}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269\|PubMed:12591613}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009788119.1	3e-72	PREDICTED: scarecrow-like protein 21
Refseq	XP_009788120.1	3e-72	PREDICTED: scarecrow-like protein 21
Refseq	XP_016463344.1	2e-72	PREDICTED: scarecrow-like protein 21
Refseq	XP_016475625.1	3e-72	PREDICTED: scarecrow-like protein 21
Swissprot	Q69VG1	2e-58	CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBL	A0A1S3ZG68	6e-71	A0A1S3ZG68_TOBAC; scarecrow-like protein 21
TrEMBL	A0A1S4AG00	7e-71	A0A1S4AG00_TOBAC; scarecrow-like protein 21
TrEMBL	A0A1U7XNQ0	7e-71	A0A1U7XNQ0_NICSY; scarecrow-like protein 21
STRING	XP_009788119.1	1e-71	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA21347	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G48150.2	2e-52	GRAS family protein

Publications ? help Back to Top
Day RB, et al. Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells. Plant Mol. Biol., 2004. 54(2): p. 261-72 [PMID:15159627]