PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf14662g01006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 472aa    MW: 53225.1 Da    PI: 6.351
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf14662g01006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS472.22.7e-144474691374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l++lLl+cA++vssg+le+a+ +L ++s+lasp+gd+mqR+a+yfteALa r++rs++++ykal++++ s   +se + + k+f+
  Niben101Scf14662g01006.1  47 LIHLLLACANHVSSGNLENANIALDHISQLASPNGDTMQRIASYFTEALADRILRSWPGIYKALRSTKLS--VVSEDILVKKMFF 129
                               689*************************************************************999998..69*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e +P+lk++++++NqaI ea+ege++vHi+D++++++lQW aLlq L++Rpegpp+lRiTgv++    +ke l +++  L++ Ae
  Niben101Scf14662g01006.1 130 EFFPFLKVAFVVTNQAIIEAMEGEKMVHIVDLNAGEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAYVLTEEAE 210
                               ****************************************************************....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll......................................... 214
                               +l++pf+f+  v+++ledl++e+Lrvk+gEala+++v+qlh+ll                                         
  Niben101Scf14662g01006.1 211 KLDIPFQFSQ-VVSQLEDLDVEKLRVKTGEALAISSVMQLHTLLghdneprkksplpfkhsngvnlhralinqntlgellekdmg 294
                               **********.799*********************************************************************** PP

                      GRAS 215 ...............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                                              +++++++ + d +L+++ +lsPkv+vv+eq+++hn+++++er++e+l+yy+alfd+le+ lpr+s er k
  Niben101Scf14662g01006.1 295 hmvnsiypnsndtasSSPLCSTTKMDVFLNALLGLSPKVMVVTEQDSNHNGTTLMERLSESLHYYAALFDCLESALPRTSLERLK 379
                               ***********9988777888889************************************************************* PP

                      GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                               vE+ llg+ei+n++aceg er+erhe+lekW +r++ aGF++vpls++a+ qa++ll+ ++s+gy+++ee+g++v++W+dr+L+s
  Niben101Scf14662g01006.1 380 VEKLLLGEEIKNIIACEGIERKERHEKLEKWFQRFDVAGFGNVPLSYYAMLQARRLLQSYNSEGYKIKEENGCVVICWHDRALFS 464
                               ************************************************************************************* PP

                      GRAS 370 vSaWr 374
                               vS+Wr
  Niben101Scf14662g01006.1 465 VSSWR 469
                               ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.59521449IPR005202Transcription factor GRAS
PfamPF035149.5E-14247469IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPIQIFP MMSLSPGFSS SNQWLKELKS EERGLYLIHL LLACANHVSS  60
GNLENANIAL DHISQLASPN GDTMQRIASY FTEALADRIL RSWPGIYKAL RSTKLSVVSE  120
DILVKKMFFE FFPFLKVAFV VTNQAIIEAM EGEKMVHIVD LNAGEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAYVLTEEAE KLDIPFQFSQ VVSQLEDLDV EKLRVKTGEA  240
LAISSVMQLH TLLGHDNEPR KKSPLPFKHS NGVNLHRALI NQNTLGELLE KDMGHMVNSI  300
YPNSNDTASS SPLCSTTKMD VFLNALLGLS PKVMVVTEQD SNHNGTTLME RLSESLHYYA  360
ALFDCLESAL PRTSLERLKV EKLLLGEEIK NIIACEGIER KERHEKLEKW FQRFDVAGFG  420
NVPLSYYAML QARRLLQSYN SEGYKIKEEN GCVVICWHDR ALFSVSSWRC RK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A7e-41354717381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019236517.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A1J6JZ680.0A0A1J6JZ68_NICAT; Scarecrow-like protein 3
STRINGXP_009761009.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]